SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017093 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017093
Domain Number 1 Region: 1791-1950
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 1951-2010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 1748-1789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000375
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017093   Gene: ENSECAG00000019596   Transcript: ENSECAT00000020800
Sequence length 2053
Comment pep:known chromosome:EquCab2:14:82868202:82908129:-1 gene:ENSECAG00000019596 transcript:ENSECAT00000020800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLSVIGHPIDSESKEDEPCSEETDPEHDLIAEILPELIEIDIYHSEEDEAEDEECANA
TDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPSQNFSDSSESGTHQFVIAIT
GLSTAMQPNESKETTESLEITWKPETYPETPEHSSSGEPDVFPTVSFHEGEATEGPESIT
ERGPELDTLVHGHTEPVPLFSEESSGDATIDQESQKMIFSGATEVTFDEEAEKRTSVTYT
PSAVPSSVSASVSEEVSVTLTEKSWPDDSLSTVESWVEITPRPIVELSGSPSIPIPEGSG
EAEEDKDKMFTAVTNLPQRSTTDTLVTLDASKIMITEGLFDISATTVYSVSEQPFAEVVP
TKFVRETDTSEWVFSTSLEGKKRKDEEVGATGTASTVQAHSPTQRSDQLILPPELEGSND
TVSRDSASATRNGFMSLITPMQSEREMTSSTLVFTETSVLDDLEAPTAEPSSSGQPVVQE
GLSPAPGSPVSLFMEQGSGEAAADPEATTVSSFSFNLEPEIQTKKEAAGTLAPHVETILP
FEPTGLVLSTVMDREVTEIINQTSKENLISEVSGEPNHGAERKGFSTDFPLEEDFSGDLR
EYSTVSYPITKEETVVMEGSGDAAFKDTQILPSAIPTSDHITHIADLEGPGSTSVSTSAF
PWEEFTASAEGSGEQLVPVSSSVDQVFPSAMGNVSGTEFPFIDQGLGEVGAITEANKRST
ILPTAEAEGTEAPTEKGEVTVDGTVSVDFPQTMEPAKLWSRQEVNPVRQGNESEVASEEN
IQEQKSSESPQSSISPEQTIFDSQTFTESGLQTTDYSTLMTKKTYRTDEEMEEEGISLVD
VTTPDPDSKGLEPYTTLPEVTEKSHLFLVTTSETESIPAESVVTDSSIKEEESIKSFPEV
MRPISKESDTDLLFSGLGSGEEVLPTAVSVNFTDVEQIISTLYPQTSQVESVETSSLNDT
TEDYKGIENVADEVRPLISKTDSISEDKETSPSTTLSEISGDTRTEGPSTALLPFSTDTE
HAQNQTRSWAEEIQTSRPQPTSEQVSSESSSTAETKETATSSTDFLARTYGLEMAKEFVT
SASKPSDSFYEHSGEGSGELDIVDLVRTSGTTQATRQGGTTFVSDKSLERHPEVSRAEAV
TVDGFPTVSVVVPLHLEQNASSPDPTSTPPSNTVSSETSSEGAADSFQDHVRGFEDSTLK
PDRRKATENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGM
PTNLDPEVPSGPHDSNEESVQEKYEAGFNLSSTEENFEGSGDLLPANYTQATHNQSMPSE
DRSQVDHRGFIFTTGIPVSSTETELDILLPTATSLPIPSKSATVNPETEVPSTESKALDD
IFESSTLSDGQAIADQSEIISTMGHLERTQDEYEEKKYVGPSFQPEFSSGAEEALIDATP
YVSISTIHLTAQSLTEAPNVLEGSSPPAYTDTTSAVSASAKLFSPTSSSPLTVHLGSGAS
EHTEGPQPSALLSTSASTSQMSPGKLANIDVTSKPSSEEYFYITEPPALPPDTQLEPSED
ETKPKSSEQIEAAPTQLVAEEGTEIPPDSQNKTNVQLPGETIKIFASIRTPEAGTVVTAA
DEVKLERATSWPHSTSASAIYGIEAHVVPQPSPQTPERPTVPSSLEVKPETQAALIRGED
FTVAAPEQQASARILDSNNQATVSTAELNTELATPSFSLLETSNETDFLIGINEESVEGT
AVYLPGPDRCKTNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCI
DGFNTFRCLCLPSYIGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAH
LTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGE
DCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRY
HCKDGFIQRHPPTIRCLGNGKWAMPKITCMNPSAYQRTYSKKYFKNSSSAKDNSINTSKH
EHRWSRRWQESRR
Download sequence
Identical sequences F7DY34
ENSECAP00000017093 ENSECAP00000017093 9796.ENSECAP00000017093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]