SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017116 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017116
Domain Number 1 Region: 726-894
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.73e-17
Family Galacturonase 0.071
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily F-box domain 7.59e-16
Family F-box domain 0.0032
Further Details:      
 
Domain Number 3 Region: 428-574
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000101
Family Pectate lyase-like 0.029
Further Details:      
 
Domain Number 4 Region: 542-677
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000002
Family Galacturonase 0.039
Further Details:      
 
Domain Number 5 Region: 108-255
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000797
Family Pectin methylesterase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017116   Gene: ENSECAG00000019472   Transcript: ENSECAT00000020825
Sequence length 956
Comment pep:known chromosome:EquCab2:25:2603943:2626657:-1 gene:ENSECAG00000019472 transcript:ENSECAT00000020825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGGLPLELWRVILAYLHLPDLGRCSLVCKAWYELILSLDSTRWRQLCLGCTECRHPNW
PNQPDVEPESWREAFKQHYLASKTWTKNALDLDSSVCFSLFRRRRERRTLSVGPGHEFDS
LGSALAMASLYDRIVLFPGVYEEQGEIVLKVPVEIVGHGKLGEVALLASIDQHCSTTRLC
NLVFMPAWFSPFMFKTTSGHVQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPL
CVLENCEFVGSENNSVTVEGHPSADKNWAYKYLLGLIKSSPSVLPTEDPDSLMSLDLESR
DQAWSPRTCDIVIEGSQSPTSPASSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSP
SGEDEDEDQLTYRLSYQVRGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLQQELQKDKEA
MALASSIQGCLIRKCLFRDGKGGVFVCSYGRAKMEGNIFRNLTYAVRCIHNSKIVMLRND
VHRCRAAGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGN
GKGIIRNNQIFSNKEAGIYILYHGNPVVSGNHIFKGRAAGIAVNENGKGLITENVIRENQ
WGGVDIRRGGVPVLRSNLICFGYSDGVVVGDEAKGLIEGTPSTSNKGCGVWMMSSSLPHV
SSNHVSYNGLYGVAVFSQKDGSGEFPGGHGAQENFSEDGDAILWETELEKDDDPLRRPVT
TALVESNSINHNGASGLYVQSSEALHIVTNVIHANGDRGITVAQSGQLTRVANNSISCNR
QSGVKVEAQCKVELRGNGIYDNRGHGIITKGDSTVVIENDIIGNRGSGLQLLPRSDTKVI
KNRIHSFRAYGIAVRGRAKALVQENIIFQGKTNKTIFQQISNNRDCVMQNNKFLVFKKKS
DTWRLVNPPARPHLDNSLRGPSAAHGGQKVTAMATRITARVEGGYHSNRSIFCTIL
Download sequence
Identical sequences F7DFA4
9796.ENSECAP00000017116 ENSECAP00000017116 ENSECAP00000017116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]