SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017139 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017139
Domain Number 1 Region: 542-623
Classification Level Classification E-value
Superfamily E set domains 4.55e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000041
Further Details:      
 
Domain Number 2 Region: 718-819
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000941
Family Ankyrin repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017139
Domain Number - Region: 1100-1149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000956
Family Motor proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017139   Gene: ENSECAG00000019370   Transcript: ENSECAT00000020849
Sequence length 1210
Comment pep:known chromosome:EquCab2:11:49548118:49562487:1 gene:ENSECAG00000019370 transcript:ENSECAT00000020849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEW
LSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCL
YGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLK
WSREELLGQLKPMFHGIKWSCGNGTEEFSVEQLVQQILDTHPTKPAPRTHACLCSGGLGS
GSLTHKCSSTKHRIISPKVEPRALTLTSVPHPQPPDPPPLIAPLPPELPKAHTSPSSSSS
SSSSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRTGGLTPTRHLAPQADPRP
SMSLAVVVGSEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVSPDFPEAEAAHSPCPA
LEPAAALEPQAAARGPPPQSGAGRRRGNCFFIQDDDSGEELKAQGATPPVPSPPPSPPPS
PAPLEPSGRVGRGEALFEGAGGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPAL
STITDFSPEWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEV
GLVSLQVAGREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRM
AEIAAAGQAPCQGPEAPPMQDEGQGPGFEARVVVLVESMIPRSTWRGPERLAHGSPFRGM
SLLHLAAAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAA
VLLFRWNRQALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEASAEPPPALSPPSSSP
DTGLSSVSSPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEITMEEVVPGQLSPGTPEGP
LLLMDYEATNPKGSPPSPPPLPPAPDGGAAPEDADSPPAVDVISVDMISLAKQIIEATPE
RIKREDFVGLPEAGAPVRERTGALGLSETMSWLASYLENVDHFPSSAPPSELPFERGRLA
IPPAPSWAEFLSASASGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQE
VAAAVIQRCYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQ
QHYRSYRRRPGPPHRPPGSLPTRTKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQEL
EGLPQPGLAT
Download sequence
Identical sequences F7DEJ6
ENSECAP00000017139 9796.ENSECAP00000017139 ENSECAP00000017139 XP_005597763.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]