SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017260 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017260
Domain Number 1 Region: 532-769
Classification Level Classification E-value
Superfamily vWA-like 1.13e-42
Family Integrin A (or I) domain 0.0026
Further Details:      
 
Domain Number 2 Region: 765-981
Classification Level Classification E-value
Superfamily vWA-like 9.35e-32
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 3 Region: 3-177
Classification Level Classification E-value
Superfamily vWA-like 1.35e-29
Family Integrin A (or I) domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017260   Gene: ENSECAG00000019436   Transcript: ENSECAT00000020988
Sequence length 981
Comment pep:known chromosome:EquCab2:26:41200743:41218017:1 gene:ENSECAG00000019436 transcript:ENSECAT00000020988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEKADCPVNVYFVLDTSESVTMQSPTDSLLYHMQQFVPQFISQLQDEFYLDQVALSWRYG
GLHFSDQVEVFSPPNSDRASFIKSLQSISSFRRGTFTDCALANMTQEIRRHVKKGVNFAV
VITDGHVTGSPCGGIKRQAERAREEGIRLFAVAPNRNLHEQGLRDIASTPLELYRSNYAT
MRPDSTDIDQDTINRIIKVMKHEAYGECYKVSCLEIPGPPGPKGYRGQKGAKGNMGEPGE
PGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGR
IGPPGCKGDPGNRGPDGYVGEAGSPGEQGDQGAKGDPGRPGRRGPPGEDGAKGSKGYQGN
NGSPGSPGVKGAKGGPGPRGPKGEPGRRGDPGTKGGPGSDGPKGEKGDPGPEGPRGLAGE
VGNKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYP
GPRGEPGEKGEPGPRGPEGGRGDFGMKGAPGRKGQKGEPADPGPPGEPGPRGPRGEPGLE
GEPGPPGDPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFV
INVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIQLDDERINSLSSFKEAVKNLEWIA
GGTWTPSALKFAYNQLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCNHDVTVTAIG
IGDMFHERHESENLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPC
QTELYVAQCTQRPVDIVFLLDGSERLGEQNFHKARRFVEEVSRRLTLARREDDPLNARVA
LLQFGGRDEQQVAFPLTSNLTAIHEALASARYLNSFSHVGAGIVHAINYVVQDARAGARR
HAELAFVFLTDGVTGNDSLEEAVHSMRKQNVVPTVVAVGSDVDADVLSKISLGDAAAVFR
EKDYDSLAQPGFFDRFIRWIC
Download sequence
Identical sequences F7CGV8
ENSECAP00000017260 ENSECAP00000017260 9796.ENSECAP00000017260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]