SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017301 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017301
Domain Number 1 Region: 172-335
Classification Level Classification E-value
Superfamily E set domains 1.96e-31
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-186
Classification Level Classification E-value
Superfamily E set domains 2.1e-29
Family Arrestin/Vps26-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017301   Gene: ENSECAG00000019506   Transcript: ENSECAT00000021030
Sequence length 414
Comment pep:known chromosome:EquCab2:14:76633733:76646299:1 gene:ENSECAG00000019506 transcript:ENSECAT00000021030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFNTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLGLSLPERPEAPPSYAEVVTEEQRRN
NLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR
Download sequence
Identical sequences F7BVB7
ENSECAP00000017301 XP_001504666.1.31192 XP_004263586.1.21590 XP_007105554.1.24612 XP_007197492.1.59432 XP_007469825.1.90284 XP_008507322.1.77740 XP_012577144.1.23501 XP_014712569.1.49734 XP_019496689.1.44202 XP_019785264.1.83887 9796.ENSECAP00000017301 ENSECAP00000017301 ENSTTRP00000000649 ENSTTRP00000000649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]