SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017324 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017324
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily Sema domain 1.44e-60
Family Sema domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1110-1239,1416-1602
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.45e-48
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 597-691
Classification Level Classification E-value
Superfamily E set domains 1.28e-17
Family Other IPT/TIG domains 0.0056
Further Details:      
 
Domain Number 4 Region: 689-779
Classification Level Classification E-value
Superfamily E set domains 0.000000000000118
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 5 Region: 265-314
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 777-889
Classification Level Classification E-value
Superfamily E set domains 0.0000407
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017324
Domain Number - Region: 560-594
Classification Level Classification E-value
Superfamily Plexin repeat 0.00314
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number - Region: 1264-1355
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0448
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017324   Gene: ENSECAG00000019242   Transcript: ENSECAT00000021057
Sequence length 1635
Comment pep:known chromosome:EquCab2:28:45740058:45753571:-1 gene:ENSECAG00000019242 transcript:ENSECAT00000021057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDGYLSTNTQQFVAAFEDGLYVFFVFNQQDKHPPRNRTLLARMCKQDPFYYSYLEMDLQC
LDPSDVQAPAFGTCLAASVAVPGAARVLYAVFSKDGRGGGGPRAGLCLFPLDEVHAKMEA
NRNACYTGTRDAGRDTFYKPFHGDIQCGGHGQGASESFPCGSEHLPYPLGSRDGLTAMAV
LQRGGLNLTAVTVTAENGHTVAFLGTSDGRVLKVYLTPDGSPAEYGSILVEINKRIKQDL
VLSADLSSLYAMTQDKVFRLPVQECLSHLNCAQCRSSQDPYCGWCVVEGRCTRRAECPRA
NESGHWLWSRDESCVAITGAQPQNMSRRAQGEVQLTVSPLPALREEDELLCLFGESPPHS
ARVEGDAVICNSPSNIPSTPPGQDHVAVNVQLLFRHGNIFLTSHLYPFYDCREAMSLVEN
LPCISCASNRWTCQWELRYHECREASPNPEDGIVRAHMEDNCPQFLNPSPLVIPMNHETD
VTFQGKNLDTVKGTSLHVGSDLLKFEEPVSVQGPGTFFFRTPKLSHDANETLPLHLYVKS
YGKNIDSKLQVTLYNCSFGRSDCSLCLAADPTYQCVWCSGQGRCVYKALCSNATSECPPP
VITRIQPETGPLGGGIRVTIHGSNLGVRADDVKRVTVADRNCTFEPERYSVSTRIVCAIE
AAEAPSTGGVMVEVNGKFGYSPPHVQFTYQQPQPLSVEPKQGPQAGGTTLTISGTHLDTG
SEEDVRVTLSDVPCKVTQFGAQLQCVTGPQVSLGELHLEIYYGGSLVPSPGVTFTYRENP
VLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVVIAEPLQSWRRRREAGPLQPTMVVGT
EYTFYNDSKVVFLSPAVPEEPEAYNLTALIQMDGHRVLLRTEAGAFEYVADPTFENFTGG
VKKQVNKLIHARGTNLNKAMTLHEAEAFVGAERCIMKTLTETDLYCEPPEVQPPPKRRQK
RDTTNNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSLILPLVIVPMVAVIAVSVYCYWRK
SQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPVLDYKTYTDR
VFFLPSKDGDKDVMITGKLDIPESRRPVVEQALYQFSNLLNSKSFLINFIHTLENQREFS
ARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSN
WMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPL
TVSVIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSRWPKADSVVLEWRPGSTA
QILSDLDLTSQREGRWKRINTLMHYNVRDGATLLLSKVGVSQQPEDSQQDLPGERHALLE
EENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV
LAPGKAVPPAVKYFFDFLDEQAEKHDIRDEDTVHIWKTNSLPLRFWVNILKNPHFIFDVH
VHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMV
QVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEDDPAAQKMQLAFR
LQQIAAALENKVTDL
Download sequence
Identical sequences F7BUK0
ENSECAP00000017324 ENSECAP00000017324 9796.ENSECAP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]