SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017348 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017348
Domain Number 1 Region: 42-396
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.65e-62
Family beta-glycanases 0.0021
Further Details:      
 
Domain Number 2 Region: 388-561
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.66e-40
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0067
Further Details:      
 
Domain Number 3 Region: 542-637
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000964
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017348   Gene: ENSECAG00000019632   Transcript: ENSECAT00000021084
Sequence length 644
Comment pep:known chromosome:EquCab2:3:119067348:119083096:-1 gene:ENSECAG00000019632 transcript:ENSECAT00000021084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPLRPRTTLLTLFAALLIAHRAALGEAPYLVRVDAARVVRPLRPFWRSTGFCPPLPHSR
ADQYDLSWDQKLNLAYVGAIPHGGIEQVRTHWLLDLITARGSAGEGLSYNFTHLDRYLDL
LRENQLLPGFELMGSPSGHFTDFEDKQQVFEWKDLVSLLARRYIGRYGLAHVSKWNFETW
NEPDHHDFDNVSMTMQGFLNYYDACSEGLRVASPALRLGGPGDSFHPPPASPLCWALLEH
CHHGSNFFTGELGVRLDYIALHKKGAGSSIYILEQEKATVRQVQHLFPRFADTPIYNDEA
DPLVGWSLPQPWRTDVTYAAMVVKVIAQHQNLLVANDSSSIRYALLSNDNAFLSYHPHPF
SQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLGEEQLWAEVSQAGAVLDSNHTVGV
LASAHRPAGPVDAWRATVLVYASDDTRAHANRSVAVTLRLHGVTPGPGLVYVTLYLDNRV
CSPHTEWQRLGRPVFPSAEQFRRMRAAEDPVASAPRPFPTGGRLTLRPQLPLPSLLLVHL
CARPEKPPGQVTRLRALPLTRGQLLLVWSDEHVGSKCLWTYEIQFSPEDKGYTPISRKPS
TFNLFVFSPDTVVVSGFYRVRAVDYWARPGPFSDPVQYLEVLAT
Download sequence
Identical sequences F7E202
ENSECAP00000017348 9796.ENSECAP00000017348 ENSECAP00000017348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]