SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017365 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017365
Domain Number 1 Region: 146-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.41e-124
Family Transglutaminase core 0.00000000505
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily E set domains 4.55e-42
Family Transglutaminase N-terminal domain 0.0000865
Further Details:      
 
Domain Number 3 Region: 497-608
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 611-706
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.96e-23
Family Transglutaminase, two C-terminal domains 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017365   Gene: ENSECAG00000019808   Transcript: ENSECAT00000021102
Sequence length 709
Comment pep:known chromosome:EquCab2:22:20231208:20254948:-1 gene:ENSECAG00000019808 transcript:ENSECAT00000021102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSGIRVTEVDWQQLRNGAAHHTQEYPGPELVVRRGQIFTITLELNRSLDSEETFIFTVE
TGPQASEGLRTKAVFQTSTSELEVGDAWTAVKEAQAEDTVTVSLASPPNAVIGRYLLSAR
VSSRRKHSDRKLGEFILLFNPWCPEDNVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGW
NFGQFEEDILNICLSILDRSPSHQDDPATDVSHRHDPIYVTRAISAMVNSNNDRGVVQGQ
WQRKYGGGTSPLHWRGSVAILQQWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRVVSN
FNSAHDTDRSLSVDKYVDSFGRTLEYLTEDSMWNFHVWNESWFARQDLGPFYSGWQVLDA
TPQEESEGVFRCGPASVAAIREGDVHLAHDGPFVFSEVNADYITWLWNEDESRERVYSDT
KKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYRRAVKKLFSVEASGRRARVRRAS
GRGLWRDDLLQPAAKPSITGKFKVLEPPKLGHDLRLALCLANLTSQTQQVQVNLSGATIL
YTRRPVAEILHESHKVRLGPEEERKIPITISYSQYKEDLTEDKKILLAAMCLVTKGEKLL
VEKDITLEDFITIKVLGPAVVGMAVVVEVMVVNPLLERVEDCVLMVEGSGLLRGQLSIDV
PSLEPQERASVRFNITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVAKAK
Download sequence
Identical sequences F7E1G9
9796.ENSECAP00000017365 ENSECAP00000017365 ENSECAP00000017365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]