SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017420 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017420
Domain Number 1 Region: 375-551
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000217
Further Details:      
 
Domain Number 2 Region: 552-677
Classification Level Classification E-value
Superfamily E set domains 3e-33
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017420   Gene: ENSECAG00000019813   Transcript: ENSECAT00000021168
Sequence length 784
Comment pep:known chromosome:EquCab2:8:93204459:93314181:1 gene:ENSECAG00000019813 transcript:ENSECAT00000021168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHYSYASSSIGSGLPLSTAHPSLPAPCHDLQTVAPGISAVASASHPSGYGGAVDSGPSGY
FLSSSNVRPNGAPALESPRIEITSYLGLHHNNNQFFHDVEVEDVVPNSKRSPSTATLNLP
NLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEG
YPRGLGACSLLSSPRHSPSTSPRASVTEESWLGARTSRPSSPCNKRKYGLNGRQLSCSPH
HSPTPSPHSSPRVSVTDDTWLGNSTQYTSSAIVAAINALSTDSSLDLGDGVPVKTRKTAL
DHSPSVALKVEPAGEDLGTTPPTSDFLPEEFSSFQHIRKGAFCDQYLSVPQHPYQWARPR
SPTSYTSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPSVQ
LHGYLESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEVILSNTKVLEIPLL
PENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVAS
NPIECSQRSAQELPLVEKQSLSSCPVLGGKKMVLSGHNFLQDSKVVFVEKAPDGHHIWEM
EAKTDRDLCKPNSLVVEIPPFRNQRITSPVQVNFYVCNGKRKRSQYQHFTYLPANVPIIK
TEPTDDYEPALTCGPMSQGLSPLPKPCYSQQLAMPPDPGSCLVAGFPPCPQRGSMMSPPP
SASPKLHDLSSAPYSKGMASPGHSHLGLQRPAGGVLAVQEAPRPVGVHPGSPQQPPPALL
QPQQ
Download sequence
Identical sequences F7DI09
ENSECAP00000017420 ENSECAP00000017420 9796.ENSECAP00000017420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]