SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017531 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017531
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-50
Family SPRY domain 0.00089
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-17
Family B-box zinc-binding domain 0.0000381
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000103
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000171
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017531
Domain Number - Region: 108-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000636
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017531   Gene: ENSECAG00000019648   Transcript: ENSECAT00000021293
Sequence length 667
Comment pep:known chromosome:EquCab2:X:6587583:6700891:-1 gene:ENSECAG00000019648 transcript:ENSECAT00000021293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
ERVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTSLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLMEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCHNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDITFSQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences F7CLC3
XP_005614032.1.31192 XP_005614033.1.31192 XP_014584244.1.31192 XP_014710887.1.49734 XP_014710888.1.49734 ENSECAP00000017531 ENSECAP00000017531 9796.ENSECAP00000017531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]