SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017556 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017556
Domain Number 1 Region: 947-1016
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 2 Region: 2333-2405
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 3 Region: 1849-1975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.69e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 2052-2120
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-17
Family TB module/8-cys domain 0.000011
Further Details:      
 
Domain Number 5 Region: 1525-1598
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-17
Family TB module/8-cys domain 0.0000125
Further Details:      
 
Domain Number 6 Region: 2130-2260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.26e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 2447-2573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 534-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.47e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 9 Region: 448-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 1025-1166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.12e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 12 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.23e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 14 Region: 1194-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.32e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 16 Region: 723-847
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000141
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 17 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000405
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 18 Region: 649-719
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000576
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 19 Region: 2573-2689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 20 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 21 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000148
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 22 Region: 2009-2057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000551
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 23 Region: 1765-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000628
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 24 Region: 1153-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000133
Family EGF-type module 0.008
Further Details:      
 
Domain Number 25 Region: 1968-2011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 26 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 27 Region: 1444-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000313
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 28 Region: 2286-2334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 29 Region: 1808-1845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 30 Region: 2404-2452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 31 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017556
Domain Number - Region: 2249-2291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017556   Gene: ENSECAG00000018455   Transcript: ENSECAT00000021326
Sequence length 2873
Comment pep:known chromosome:EquCab2:1:141192400:141419396:1 gene:ENSECAG00000018455 transcript:ENSECAT00000021326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGLLEVALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCICQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVTQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALANGRCSNQLPQSITKMQCCC
DVGRCWSPGATIAPEMCPIRATEDFNKLCSVPMVIPERPGYPPPPLGPVPPVHPVPPGFP
PGPPLPAPRPPVEYPYPSREPPRVLPVNVTDYCQLFRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRTGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCVKPLFGAVTKSECCCANTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGACKNSPGSFICECTSESSLDP
TKTICIETTKGTCWQTIIDGRCEININGAILKSQCCSSLGAAWGSPCSKCQVDPICGRGY
SRIKGTQCEDIDECEVFPGVCKNGLCINSKGSFKCECPSGMTLDATGRICLDIRLETCFL
RYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEIT
NGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCEC
PAGHQLSPNISACIDINECELSAHLCPHGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSAD
GKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDVRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNGNYRNECQEIPN
ICSHGQCIDTVGSFYCICHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNH
GFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECL
LEPGKCAPGTCQNLDGSYRCICPPGYSLHNDKCEDIDECVEEPEICALGTCSNTEGSFKC
LCPDGFSLSSTGRRCQDLRTSYCYAKFEGGKCSSPKSKNHSKQECCCALKGEGWGDPCEL
CPTEPDEAFRQICPYGSGIIVAIDDSAVDMDECGEPDVCKHGQCINTDGSYRCECPFGYI
LEGNECVDIDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCA
FRCVNTYGSYECKCPTGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYICICGP
GYQRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPAQDECLDNREGY
CFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMT
NGADIDECKVIHDVCRHGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFI
CKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQH
HTSCIDNNECTSDINLCGSRGICQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNHRCQ
HGCQNIIGGYRCSCPQGYLQHYQWNQCVNENECLSAHICGGASCHNTLGSYKCMCPAGFQ
YEQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCACPPGYFRIGQGHCVSGMGMGRGGTE
PPSSSEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIKNQPEIEANVSLASWDV
EKTAMFAFNISHISNKVRILELLPALTTLTNHNRYLIESGNENGFFKINQKEGISYLHFT
KKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences F7CKI7
ENSECAP00000017556 9796.ENSECAP00000017556 ENSECAP00000017556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]