SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017564 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017564
Domain Number 1 Region: 377-640
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-52
Family YWTD domain 0.000000000277
Further Details:      
 
Domain Number 2 Region: 261-373,644-690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 120-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 4 Region: 81-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 5 Region: 4-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00028
Further Details:      
 
Domain Number 6 Region: 40-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 7 Region: 213-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 8 Region: 175-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017564   Gene: ENSECAG00000019557   Transcript: ENSECAT00000021336
Sequence length 840
Comment pep:known chromosome:EquCab2:7:49080353:49100303:-1 gene:ENSECAG00000019557 transcript:ENSECAT00000021336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGECGRREFQCRDGKCISYKWVCDGRAECSDSSDEAPETCMSVTCMAGDFSCGGRVNRC
IPQFWRCDGQVDCENGSDEQGCPPKTCAQDEFRCLDGKCIAREFVCDADRDCLDGSDEAS
CPAPTCGPASFQCNSSACIPELWACDGDPDCKDGSDEWPQRCGARDAAPPRDDSPCSALE
FHCSSGECVHSSWRCDGDPDCRDKSDEDNCAVATCQPDEFQCSDGTCIHGSRQCDKEYDC
KDMSDELGCVNVTLCEGPSKFKCRSGECIPLDKVCNSARDCEDWSDEPLRQCGTNECLDN
NGGCSHICSDLKIGHECLCPEGFRLVDQRRCEDIDECQDPDACSQLCVNLEGSYKCECEA
GFQLDPLTKACKATGTIAYLFFTNRHEVRKMTLDRSEYTSLIPNLKNVVALDTEVASNRV
YWSDLSQRKIYSTQIDRAPGFSSYDTVIGEDLQAPDGLAVDWIHGNIYWTDSVLGTVSVA
DTKGLKRKTLFKEKDSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTEDIQ
WPNGITLDLSGGRLYWVDSKLHSISSIDVNGGDRKTILEDKKKLAHPFSLAVFEDKVFWT
DIINEAIFSANRLTGSDIHLMAENLLSPEDIVLFHNLTQPRGVNWCERTALHNGGCQYLC
LPAPQINPRSPKFTCACPDGLVLAKDMRSCHTETEAVATTRGPSTARPVASSTVRPTGSS
AVVGPKHTASSWSMASPELTTAETVTVSHQALGDAAGRGGEERPRGVGALSIVLPIALLI
VLCFGTFLLWKNWRLKNVNSIHFDNPVYQKTTEDEVHICRSQDGYTYPSRQMVSLEDDVA
Download sequence
Identical sequences F7CG52
9796.ENSECAP00000017564 ENSECAP00000017564 ENSECAP00000017564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]