SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017595 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017595
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.21e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 486-704
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.6e-56
Family Ankyrin repeat 0.0000101
Further Details:      
 
Domain Number 3 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 4.2e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 4 Region: 769-847
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000353
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017595   Gene: ENSECAG00000019593   Transcript: ENSECAT00000021368
Sequence length 898
Comment pep:known chromosome:EquCab2:1:27754271:27760597:-1 gene:ENSECAG00000019593 transcript:ENSECAT00000021368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYDPGLDGIIDYDDFKFNPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTETERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQHFGGGSHMGGGS
GGSAGGYGGAGGGGGSLGFFSSLTYNPQSGAAPMGCYPGGGGGAQMAAGAPSVDAGEEAA
EPSASPVIPQHEPQAPELLQQAREYNERLFGLARRSARALLDYGVTADARALLAGQRHLL
TAQDENGDTPLHLAIIHGQTSVIEQIAHVIYHAQHLGVVNLTNHLHQTPLHLAVITGQTR
VVSFLLQVGADPALLDRHGDSAVHLALRVGAGAPDLLRALLQSGVPAMPQLLHLPDFEGL
YPVHLAVRARSPECLDLLVDNGAEVEAAERQGGRTALHLATEMEELGLVTHLVTKLRANV
NARTFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPE
RDIRSSFRGHTPLDLTRSSKVKTLLLNAAQDTMAPPLTPPSPAGPELPLEDTVLQNLEHL
LDGPGAQGSWAELAERLGLRSLVDTYRKTASPSGSLLRSYKLAGGDLAGLLDALSDMGLE
EGVRLLRGPEARDKLPSTEAKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences F7CFE2
9796.ENSECAP00000017595 ENSECAP00000017595 ENSECAP00000017595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]