SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017620 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017620
Domain Number 1 Region: 183-310
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-24
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 385-434
Classification Level Classification E-value
Superfamily RING/U-box 0.00002
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017620   Gene: ENSECAG00000020010   Transcript: ENSECAT00000021397
Sequence length 449
Comment pep:known chromosome:EquCab2:20:15315201:15333476:1 gene:ENSECAG00000020010 transcript:ENSECAT00000021397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLQCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSAALNSIVAKHKDLEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRHVPLCDTVTSAVMMQYSRDLKGHL
ASLFLNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSEHSPPNSPLKSSES
STNCRSCEGLSCQQSRVLQEKLRKLKEAMLCMVCCAQEINSTFCPCGHTVCCESCAAQLQ
SCPVCRSRVDHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences F7BU30
ENSECAP00000017620 9796.ENSECAP00000017620 ENSECAP00000017620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]