SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017640 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017640
Domain Number 1 Region: 449-816
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.02e-104
Family Hect, E3 ligase catalytic domain 0.0000035
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily E set domains 0.00000000187
Family Filamin repeat (rod domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017640   Gene: ENSECAG00000019899   Transcript: ENSECAT00000021420
Sequence length 823
Comment pep:known chromosome:EquCab2:24:20190021:20213632:-1 gene:ENSECAG00000019899 transcript:ENSECAT00000021420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PSSNVVKVAFTVRKAGRYEISVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSTSLRDEHNYSLSIHELGPQEEESTGVSFEKSVTSNRQT
CQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSENEKNIVERNVSTSGVSIYFEAY
LYNATNCTSTPWHLPPMHMSSSQRRPSTAVEEEDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHPN
PNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAV
VVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences F7BTE5
ENSECAP00000017640 9796.ENSECAP00000017640 XP_001490985.3.31192 XP_008514659.1.77740 XP_014691178.1.49734 ENSECAP00000017640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]