SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017711 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017711
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 6.15e-98
Family Subtilases 0.00000000000549
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.1e-42
Family Proprotein convertase P-domain 0.000000374
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.33e-23
Family Prohormone convertase 1 pro-domain 0.0033
Further Details:      
 
Domain Number 4 Region: 585-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000124
Family Growth factor receptor domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017711   Gene: ENSECAG00000019913   Transcript: ENSECAT00000021500
Sequence length 793
Comment pep:known chromosome:EquCab2:1:93028199:93034609:1 gene:ENSECAG00000019913 transcript:ENSECAT00000021500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPWLLWVVAAAIALVLLAADARGQKVFTNTWAVRIAGGPAVADSVARKHGFLNLGQI
FSDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGITQRDLNVKDAWAQGYTGRGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQLGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPSH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPTPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFTPQVLNTHYSTENDVETIRASVCAPCHVSCATCQGPAPTDCL
TCPSHASLDPVELTCSRQSQSSRESPQQQRPGPPPEVQAEPRLRAGLLPSHLPEVVAGLS
CAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGR
GERTAFIKDQSAL
Download sequence
Identical sequences F7DHR9
ENSECAP00000017711 XP_001502775.1.31192 XP_005602832.1.31192 9796.ENSECAP00000017711 ENSECAP00000017711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]