SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017796 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017796
Domain Number 1 Region: 651-722
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 3.66e-20
Family Anaphylotoxins (complement system) 0.0000515
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017796
Domain Number - Region: 790-822
Classification Level Classification E-value
Superfamily E set domains 0.0434
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017796   Gene: ENSECAG00000020296   Transcript: ENSECAT00000021598
Sequence length 899
Comment pep:known chromosome:EquCab2:25:24714800:24752168:-1 gene:ENSECAG00000020296 transcript:ENSECAT00000021598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYVISAPKVFRVGASENIVIQVYGYTETFDAAVSIKSYPDKQFTYSSGHVTLSTENKFQN
SAILTVCIHPSFYLYIENILNKIHKHKKIIPSFRNSFINVLDDKYGHTSDTSIKVRVYSL
NDDLKPAKRETVLTFIDPEGSEVDIVEENDYTGIVSFPDFKIPSNPKYGVWTIQAKYKED
FSTTGTAYFEIKEYVLPHFSISIEPENSFIGYKDFNNFEVTIKARYFYNKVVSEAEVFVF
FGIREDLKDDQKEMMQKATQKTTLINGIAQVTFNSETAIKELSYESLEDINDKYLYIGVT
VTESTGGFSEEAEIPGIQYVLSPYKLNLVATPLFLKPGIPYSVKVQVKDSLDQVVGGVPV
TLNAQTVDVNQETSDLESKKSVTQSSDGVASFVVNLPSGVTVLEFNVRTDDPHLPEENQA
SKDYQAIAYSSLSQSYLYIDWTENYKTLLVGEHLSIIVTPKSPFIDKITHYNYLILSKGK
IVHFGTREKLPDSSYQSINIPVTQNMVPSARLLVYYIVTGEQTAELVSDSVWLNIEEKCG
NQLQVRLSPRAGAYSPGQQVSLNMATESDSWVALSAVDSAIYGVQMKTKRPMERVLQALE
KNDLGCGAGGGRNNADVFHLAGLTFLTNANADDTPENDEPCKEILRPRRMLQKRIEEEVA
KYKHAKIKRCCYDGAFRNDLETCEQRAARITIGPRCVQVFKDCCAIAEQLRANESHKHIQ
LGRLHIKTLLPVTKPEIRSYFPESWLWEVHHVLKRNQLQFVLPDSLTTWEIQGVGISNSG
ICVADTLKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVKMPPVEGITSE
SLGVGPGGSRPSRCAPEIEGSSSHLVTFSMLPLEGLHKINFSLETSLGKEILVKTLRVV
Download sequence
Identical sequences F7D7B5
ENSECAP00000017796 9796.ENSECAP00000017796 ENSECAP00000017796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]