SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017902 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017902
Domain Number 1 Region: 472-693,720-821
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-66
Family Pancreatic carboxypeptidases 0.00000495
Further Details:      
 
Domain Number 2 Region: 298-456
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.17e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 821-910
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.41e-20
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017902   Gene: ENSECAG00000019884   Transcript: ENSECAT00000021714
Sequence length 1052
Comment pep:known chromosome:EquCab2:4:14949242:14957077:1 gene:ENSECAG00000019884 transcript:ENSECAT00000021714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPEKVKDKGKKGKKDKGPKATKQPLEGSPRPPKKPKEKPPKATKKPKEKPPKATKKPKEK
PPKATKKPKEKPPKATKKPVAGKRLPTPTPSETPWWPLPRPPGPGPEEKLPQEGGGALPS
PWQGPGGETDVEHQPELEEETEQPTLDYNDQIEREDYEDFEYIRRQKQPRPPPSRRRPER
PWPERPEEKPELPRPGERIELPLKPLPPPPLPDYGDGYGVPDYDDMDYYFRPPRPQKPYT
ELETDEEKEGLKKPKKEGGSPKEEETDDKWTVEKGKDPKGPRKGEELEEEWAPTEKVKCP
PIGMESHHIEDNQIRASSMLRHGLGAQRGRLNIQAGATEDDYYDGAWCAEDDAQTQWIEV
DTRRTTKFTGVITQGRDSSIHDDFVTSFFVGFSNDSQTWVMYTNGYEEMTFHGNVDKDTP
VLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGCPVSPVHSYYTQNEVVTTDNLDFRHHS
YKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIYAMEISDNPGDHELGEPEFRYTAGIHG
NEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNW
ALGLWTEEGFDIYEDFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRA
IIAWMEKNPFVLGANLNGGERLVSYPYDMARTPSQEQLLAAAMAAARGEDEDEASEVQET
PDHAIFRWLAISFASAHLTMTEPYRGGCQAQDYTSGMGIVNGAKWNPRSGTINDFSYLHT
NCLELSIYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVTDEQGIPIANATIS
VSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSN
WKRIREILAMNGEPIPHIDPSRPMTPQQRRMQRRLQHRLRMREQMRLRRLNATASPATSP
TSPPTSPPTTPTLLPTPTLAPSPAPSSTLGPWHFIPETTANWEESETETYTEVVTEFGTE
LGPEEEEEEEMVTGPEFPFTTAETYTVNFGDF
Download sequence
Identical sequences F7C2Y5
9796.ENSECAP00000017902 ENSECAP00000017902 ENSECAP00000017902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]