SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018049 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018049
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily E set domains 3.64e-82
Family RhoGDI-like 0.00000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018049   Gene: ENSECAG00000020501   Transcript: ENSECAT00000021877
Sequence length 204
Comment pep:known chromosome:EquCab2:11:1371873:1373318:1 gene:ENSECAG00000020501 transcript:ENSECAT00000021877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSTDPNVPNVVVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR
FTDDDKTDHLSWEWNLTIKKEWKD
Download sequence
Identical sequences F6W039
9796.ENSECAP00000018049 ENSECAP00000018049 XP_001488291.1.31192 XP_008518627.1.77740 XP_014719869.1.49734 ENSECAP00000018049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]