SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018064 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018064
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-49
Family Galectin (animal S-lectin) 0.0000613
Further Details:      
 
Domain Number 2 Region: 179-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-47
Family Galectin (animal S-lectin) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018064   Gene: ENSECAG00000019932   Transcript: ENSECAT00000021892
Sequence length 311
Comment pep:known chromosome:EquCab2:11:41572047:41583509:1 gene:ENSECAG00000019932 transcript:ENSECAT00000021892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFICAQPPYLNPVVPFSGIIQGGLQDGLQITVIGTILPFNGTRFAVNFQIGSSDNDIAF
HFNPRFENGGYLVCNTKQNGCWGREERKMHLPFQRGSPFELIFLVQSSHFQVMLNGSPFV
QYPHRVPFHRVDTLSINGIVQLFSISFQRQTMIHTPLSAPQQMYPNPAFPPMAYPNPAYP
MPFFTSIPGGLYPSKRIFVSGTVLPSAQRFHINLRSGSDIAFHLNPRFDENTVVRNTHVN
GSWGHEERSLCGKMPFTRGQSFSVCITCEGHCLRVVVDGQHLCDYNHRLKNLPGINNLEV
AGDVQLTRVQT
Download sequence
Identical sequences F6VTF3
ENSECAP00000018064 ENSECAP00000018064 XP_005597663.1.31192 XP_008520811.1.77740 9796.ENSECAP00000018064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]