SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018144 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018144
Domain Number 1 Region: 1765-1879
Classification Level Classification E-value
Superfamily CalX-like 1.07e-23
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 2 Region: 1879-2014
Classification Level Classification E-value
Superfamily CalX-like 1.83e-23
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2124-2246
Classification Level Classification E-value
Superfamily CalX-like 2.09e-21
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 4 Region: 2005-2121
Classification Level Classification E-value
Superfamily CalX-like 1.22e-19
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 5 Region: 2248-2360
Classification Level Classification E-value
Superfamily CalX-like 1.23e-19
Family CalX-beta domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018144   Gene: ENSECAG00000020410   Transcript: ENSECAT00000021980
Sequence length 3170
Comment pep:known chromosome:EquCab2:17:17232441:17395471:1 gene:ENSECAG00000020410 transcript:ENSECAT00000021980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAGTPAISSRVRHAANPTSFQPMPLPPPRLLLVLLLLLSLVSCVPAQLPAPGLALLSP
DLAGIAGVPAEEAIVLANRGLRVPFGREVWLDPLHDLVLQVQPGDRCTVAVLDNDALAQR
PGRLSPKRFPCDFGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAAVLPLVLEVEVVFTQ
LEVVTRNLPLVVEELLGISNALDARSLEFAYQPETEDCRVGILSGGALPRYGELLHYPQV
PGRASEGGAQEPLLMDCKAFQELGVRYRHTAPSRSPNRDWVPMVVELRARGSPLGSPALK
REHFQMLVRIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESTPDLLIFNL
TSPFQPGQGYLVSTDDRSLPLSSFTQRDLRFLKIAYQPPSEDSDQERLFELELEVVDPEG
AASDPFAFMVVVKPMNTMAPVVTRNTGLILYEGQSRPLTGPAGNGPQNLVISDEDDLEAV
QLEVVAGLRHGHLVLLGASSGSSAPKTFTVAELAAGQVVYHHDDKDGSLSDNLVLRMVDG
GRRHQVQFLFPITLVPVDDQPPVLNANTGLTLAEGETVPILPLALSATDMDSDDSLLLFV
LESPSSTTGHLLLRQTHPPHEEEELVRGRWRKQGEFYEKTVTEWRQQDIREGRLFYRHSG
PHSPGPVMDQFTFRVQDNHDPPNQSGLQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLT
PLRKKWLRYTDLDTDDRELRYTVTQPPMDTDENHSPAPLGTLVLTDNPSVVVAHFTQAQI
NHHKIAYRPPDQELGVAARVAQFQFQVEDRAGNVAPGTFTLYLQPVDNQPPEILNTGFTV
QEKGYHILSETELRVNDVDTDVAHISFTLTQVPKHGHIKVSGQILHVGGIFHLEDIKQGK
ISYTHNGGESLTDSCSLEVSDRHHVVPITLRVNVRPVEEEMPMQRLPAGTLGSYLDVLEN
GATEITASVIKGTDEDTDDLMLTFLLEDPPLYGEILVNGVPAEQFTQRDILEGSVVYAHT
SGEIGLLPKEDSFNLSLSDMSQEWRIGGNTIQGVTVWVTILPVDNQAPEISLGERFLVME
GDKSVITSVHISAEDIDSLNDDILCTIVIQPTSGYVENISPAPGSEKSRAGIAVSAFTLK
DLRQGHINYVQSVHKGVEPVEDRFIFRCSDGINFSERHFFPIIIIPTNDEQPEIFMREFM
VMEGMSLVIDTPILNAADADIPPDDLTFTITQFPTHGHIMNQLINGTVLVESFTLDQIIE
SSSIIYEHDDSETQEDSFVIKLTDGKHSVEKMVLIIVIPVDDETPRMTINNGLEIEIGTK
VINNKILMATDDSEDKSLVYIIRYGPGHGLQRQKPTGAFENITLGMNFTQDEVDRNLIQY
VHFGQEGIRDLIKFDVTDGINPLIDRYFYVSIGSIDIVFPDVISKGVSLKEGGKVTLTTD
LLSTSDLNSPDENLVFTITRAPMRGHLECTDQPGVSIASFTQLQLAGNKIYYIHTADDEV
KMDSFEFQVTDGHNPVFRTFRISISDVDNKKPVVTIHNLVVSEGENKLITPFELTVEDRD
TPDKLLKFTVTQVPVHGQLLFNNTRPAMVFTKQDLNENLISYRHDGSESSEDSFSFTVTD
GSHTEFYVFPDTVFETRRPQVMKIQVLAVDNSVPQIAVNKGASTLRTLATGHLGFMITSK
ILKVEDRDSLRFSLRFIVTEAPRHGYLLNLGKGNHSVTQFTQADIDDMKICYVLREGANA
TSDMFHFTVEDGGGNRLTKQHFRLNWAWISFEKEYYLINEDSKFLDVVLKRRGYLGETSF
ISIATRDGTAEKDKDFKGKAQKQVQFNPGQTRATWRVRIISDGEHEQSETFQVVLSEPVL
AALEFPAVTTVEIVDPGDESTVFIPQSEYAIEEDVGELFIPIRRSGDASQELMVICYTQQ
GTASGTVPTSVLSYSDYISRPEDHTSVVRFDKDEREKMCRIVIIDDSLYEEEETFHVRLS
MPMGGRIGSEFPEARVTIVPDKDDEPVFYFGDVRYSVDESAGYVEVRVWRTGTDLSRSSS
VTVRSRKTDPPSAEAGTDYVGISRNLDFAPGVNMQTVRVTILDDLGQPVLEGIEKFELVL
RMPMNAALGEPSKATVSINDSVSDLPKMQFKERVYTGNENDGQIVAMIHRSGDVQYRSSV
RCYTRQGSAQVMMDFEERPNTDISIITFLPGETEKPCILELMDDSLYEEVEELRLVLGTP
QSSSPFGAAVGEQNETLIRIRDDADKTIIKFGETKFSVSEPKEPGQSVIIKIPVIRQGDT
SKVSTVRVHTKDGSATSGEDYHPVSEEIEFKEGETQHIVEIEVIFDGVREMREAFTVHLK
PDENMIAETQMTKAIVYIEEMNSMADVTFPSVPQIVSLLMYDDTFRAKESAGPMSGYPVV
CITACNPKYSDYDKTGSICASENINDTLTQYRWLISAPAGPDGVTSPMREVDFDTFFTSS
KMITLDSIYFQPGSRVQCAARAVNANGNEGLELMSPIVTIGREEGLCQPRVPGIVGAEPF
SAKLRYTGPEDPEYANLIKLTVTMPHIDGMLPVISTKELSNFELTLSPDGTRVGNHKCSN
LLDYTEVKTHHGFLTDATKNPEIVGETYPYQYSSSIRGSSTLRFYRNLNLEACLWEFVSY
YDMSELLTDCGGTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPIGVGGWQHFDLKSELRL
TFVYDTAILWNDGIGSPPEAELQGSLYPTSMRIGEEGRLVVNFKTEAQFHGLFVLSHPAS
FTSSMIISADHPGLTFSLRLLRSEPTYNQPIQQWSFVSDFAVRDYSGTYTVKLLPCTTPS
HQEYRLPVTCNPREPVTFDLDIRFQQVSDPVAAEFSLNTQMYLLSKKSLWLSDGSMGFGQ
ESDVAFAEGDIIYGRVMVDPVQNLGDSFYCSIEKVFLCTGADGYVPKYSPTNAEYGCLAD
SPSLLYRFKIVDKAQPETQATSFGNILFNAKLAVDDPEAILLVNQPGSDGFKVDSTPLFQ
VALGREWYIHTIYTVRSKDNTNRGIGKRSVEDQYHSLVTQGKPPANTKSRKRREMRSTPP
LAWEIGAENNRGTNIQHIALDRTNKKQIPQGRVPPDGVLPRELNSPSSEVSLVMIVGGIT
VGLLTLCLTALPVMMCKSKKSARRKEAPKGSGSSEPMMLPQSHPSDSSEV
Download sequence
Identical sequences F6UMI7
ENSECAP00000018144 9796.ENSECAP00000018144 ENSECAP00000018144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]