SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018200 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018200
Domain Number 1 Region: 224-383
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000279
Further Details:      
 
Domain Number 2 Region: 11-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-32
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 3 Region: 124-221
Classification Level Classification E-value
Superfamily LCCL domain 2.48e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018200   Gene: ENSECAG00000020614   Transcript: ENSECAT00000022046
Sequence length 708
Comment pep:known chromosome:EquCab2:19:56079661:56148446:1 gene:ENSECAG00000020614 transcript:ENSECAT00000022046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGDGCGHTVLGPESGTLASINYPHTYPNSTVCEWEIRVRPGDRVRFRFGDFDIEDSDSCH
FNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKSNEITVLFMSGIHVSGRGFLASYSVI
DKQDLITCLDTAASFSEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVS
NVLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADAQ
ITASSVLEWTDHTGQENSWKPAKARLKKPGPPWAALATDEYQWLQVDLNKEKKITGIVTT
GSTMVEHNYYVSAYRVLYSDDGQRWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIAR
FIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKFTQPPPPWNSNDLKSTTAPPKVAKGRAP
KFTQPLQPRSSHEFPAQTEQTTATPDIRNTTVTPHGTKDVALAAVLVPVLVMVLTTLILI
LVCAWHWRNRKKKTEGTYGLPSWDRAGWWKGMKQFLPAKALEPEETPVHYSSSEVAHLSP
REVPTALQADSAEYAQPLVGGIVGALHQRSTFKPEERKEAGYADLDPYNAPVQEVYHAYA
EPLPVTGPEYATPIVVDMSGHPTAAVALPSTSTFKAAGNQAPPGVGTYNTLLCRTDSCSS
ARAQYDTPKAGPPGPRAADELVYQVPQSTQEGAGAGRGGEGDVFKEIL
Download sequence
Identical sequences F6TK78
ENSECAP00000018200 9796.ENSECAP00000018200 ENSECAP00000018200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]