SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018229 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018229
Domain Number 1 Region: 120-453
Classification Level Classification E-value
Superfamily Subtilisin-like 5.24e-88
Family Subtilases 0.00000000199
Further Details:      
 
Domain Number 2 Region: 454-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.85e-40
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 31-103
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.53e-22
Family Prohormone convertase 1 pro-domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018229   Gene: ENSECAG00000020422   Transcript: ENSECAT00000022083
Sequence length 754
Comment pep:known chromosome:EquCab2:14:72344138:72386602:1 gene:ENSECAG00000020422 transcript:ENSECAT00000022083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAWTLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSILRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYDN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWSSVPEKKECVVKDNDFEPRALT
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDSGEEQPTQENLTTNPLASKSPSGSSSVGGRRAELA
EGAPSEAMLRLLQSAFSKNPAAQQSPKKSPSAKLNIPYENFYQALEKLNKPSQLKDSEDS
LYNDYVDVFYNTKPYKHRDDRLLQALVDILREEN
Download sequence
Identical sequences F6TCF0
9796.ENSECAP00000018229 XP_001504658.1.31192 XP_008532746.1.77740 ENSECAP00000018229 ENSECAP00000018229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]