SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018262 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018262
Domain Number 1 Region: 250-514
Classification Level Classification E-value
Superfamily NHL repeat 5.49e-51
Family NHL repeat 0.000056
Further Details:      
 
Domain Number 2 Region: 132-226
Classification Level Classification E-value
Superfamily E set domains 5.8e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018262   Gene: ENSECAG00000020845   Transcript: ENSECAT00000022123
Sequence length 514
Comment pep:known chromosome:EquCab2:16:51357769:51377427:-1 gene:ENSECAG00000020845 transcript:ENSECAT00000022123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLEST
ISAVQQVLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKS
FGFVSSGAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGN
LFGAEVSDQQNGTYVVSYRPQLEGEHLVSVTMCNQHIENSPFKVVVKSGRSYVGIGLPGL
SFGSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGTFHHKFGTLGSRPGQFD
RPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKI
LVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVI
HPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQ
GSGFGQMDRPSGIAVTPDGMIVVVDFGNNRILIF
Download sequence
Identical sequences F6T413
9796.ENSECAP00000018262 ENSECAP00000018262 ENSECAP00000018262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]