SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018271 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018271
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 191-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000377
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018271
Domain Number - Region: 227-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000839
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018271   Gene: ENSECAG00000020778   Transcript: ENSECAT00000022132
Sequence length 393
Comment pep:known chromosome:EquCab2:15:15168755:15208263:1 gene:ENSECAG00000020778 transcript:ENSECAT00000022132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSCPRALFLLLLLLACPESRASQNCLNKQQLLTAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVNRVGPDAPPVSCPALNAPLDGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPRCKDISECSSQPCQNGGTCVEGVNQYKCICPPGRTGSRCQHQAQTDVN
ECELYGQEGRPRLCMHACVNTPGSYRCACPSGYRTLADGKSCEDIDECASPQHVCPRGTL
CINTGGGFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPS
NLKTPITLFRMATASAPGRPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQ
TLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences F6WD07
XP_001916583.2.31192 ENSECAP00000018271 9796.ENSECAP00000018271 ENSECAP00000018271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]