SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018331 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000018331
Domain Number - Region: 61-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0706
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018331   Gene: ENSECAG00000020906   Transcript: ENSECAT00000022196
Sequence length 97
Comment pep:known chromosome:EquCab2:16:21121604:21131617:1 gene:ENSECAG00000020906 transcript:ENSECAT00000022196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKW
WCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKASI
Download sequence
Identical sequences F6VBE9
9796.ENSECAP00000018331 ENSECAP00000018331 ENSECAP00000018331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]