SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018390 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018390
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily AMPKBI-like 6.02e-36
Family AMPKBI-like 0.00000461
Further Details:      
 
Domain Number 2 Region: 76-156
Classification Level Classification E-value
Superfamily E set domains 3.36e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018390   Gene: ENSECAG00000020796   Transcript: ENSECAT00000022270
Sequence length 272
Comment pep:known chromosome:EquCab2:5:48870945:48882603:1 gene:ENSECAG00000020796 transcript:ENSECAT00000022270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPTSDRVAGERHGAKSARAEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences F6UUV8
ENSECAP00000018390 9796.ENSECAP00000018390 ENSECAP00000018390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]