SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018453 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018453
Domain Number 1 Region: 312-480
Classification Level Classification E-value
Superfamily vWA-like 5.93e-19
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018453   Gene: ENSECAG00000020901   Transcript: ENSECAT00000022336
Sequence length 943
Comment pep:known chromosome:EquCab2:5:77507513:77552085:-1 gene:ENSECAG00000020901 transcript:ENSECAT00000022336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHRDNEGLVCSLKFLILLVALSPELLSLGAGVQLQDNGYDGLLVAINPQVSEDQNLIPN
IKKMITEASFCLFNATKRRVFFRNIKILIPATWKANNYSKAKQESYEKANVIVTDWYGAH
GDDPYTLQYRGCGKEGKYIHFTPDFLLNDDLTAGYGSRGKLFVHEWAHLRWGVFDEYNNE
KPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCMFIYNSTQNATASI
MFMQSLSSVVEFCNASTHNPEAPNLQNQMCSLRSAWDVITDSADFRHSSPMSETKLPPPP
TFSLLQAGDKVVCLVLDVSSKMAEADRLLRLQQAAEFYLMQIVEIHTFVGIASFNSKGEI
RAQLHQINNDDDRKLLVSYLPATVSAEAETSICSGLKKGFEVVEKLNGKAHGSVMVLVTS
GDDEHVANCLLTVQSSGSTIHTIALGSSAVENLEELSHLTGGLKFFVPDKSNSNSMIDAF
SRISSGTGDIFQQHIQLESTGENVQPHYQLKNTVTMDNSVGNDTAFLVTWQTSGPPEIVL
ADPSGRKYYTDDFVTNLTLQTARLRIPGTAKPGLWMYTLNNTHDSLQALKVTVTSRASRS
AVPPATVEAFVERDSTRFPHPMMIYANVRKGFYPILNATVTATIEPEAGDPVMLKLFDDG
AGADVIKNDGIYSRYFFSFAVNGRYSLKVHVRHSPSMSSLTHSVPGSHAMYVPGYIANGN
IQMNAPRTSVGRSEEEQKWGFSRISSGGSFSVLGVPAGPHTDVFPPCKIIDLEAVKVEDQ
VTLSWTAPGEDFDEGQANSYEIRMSKSLQNIQDDFNNAILVNTSKLTPQQAGTKEIFTFS
PKLFTEGPKYQPEGEAQENHRIYVAIRAIDRNSLKSAVSNIAQASLFIPPNSAPVLARDR
LILKGILTAMGLIGIICLTIVVTHCILNKKKTADNKENGMKLL
Download sequence
Identical sequences F6TR44
9796.ENSECAP00000018453 ENSECAP00000018453 ENSECAP00000018453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]