SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018557 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018557
Domain Number 1 Region: 766-846
Classification Level Classification E-value
Superfamily E set domains 6.02e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000702
Further Details:      
 
Domain Number 2 Region: 952-1060
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000007
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018557
Domain Number - Region: 1414-1524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000823
Family Motor proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018557   Gene: ENSECAG00000020792   Transcript: ENSECAT00000022451
Sequence length 1574
Comment pep:known chromosome:EquCab2:2:43044852:43616935:-1 gene:ENSECAG00000020792 transcript:ENSECAT00000022451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKLKVQGVECLYGCYVHSSIIPTFHRRCY
WLLQNPDIVLVHYLNVPAIEDCGKPCGPVLCSINTDKKEWAKWTKEELIGQLKPMFHGIK
WTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGSSVHHKCNSAKHRII
SPKVEPRTGGYGSHSEVQHNDVSEGKHEHSHGKGSSREKRNGKVAKPALLHQNSTEVSST
NQVEVPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSSMAVASVMGSLSQSATVFMSEVTN
EAVYTMSPTAGPNHHLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPTNVSEELVL
STTLDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSTNVRHSPPVERGFSFTA
VLTKEIKTEDTSFEQQMAKEAYSSSAAAAASSSLTLTAGSSLLPSGGGLSPSTTLEQMDF
SAIDSNKDYTSSFSQTGHSPHVHQTPSPSFFLQDASKPLPIEQNAHSSLSDSGGTFVMPT
VKTEASSQTSSCSGHVETRIESTSSLHLMQFQANFQAMGAEGEVTMETSQVAEGGEGLIK
SGELQACSSEHYLQPEPTGVIRSAGGVPILPGNVVQGLYPVAQPGLGNASNMELSLDHFD
ISFSNQFSDLINDFISVEGGSGTIYGHQLVSGESTALSQSEDGARAPFTQAEMCIPCCSP
QQGSLQLSSAEGGAGTMAYMHVAEVVSAASAQGTLGMLQQSGRVFMVTDYSPEWSYPEGG
VKVLITGPWQEASNNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISN
SVVFEYKARALPTLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKQGSGGG
GSGGGNGSGNGGGQAQCASGPGTLGSCFESRVVVVCEKMMSRACWAKSKHLIHSKTFRGM
TLLHLAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHLEAA
VVLYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPPSE
EPNTDSWMTQWHSEAINSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKH
KLNPEYFQARQEKLLSTALSLEQPNIRKQSPSSKQSVPETISPSEGVRDYSRELSPPTPE
TAGFQASGSQPVVKWNSKDLYIGVSTVQVTGNPKGTSVGKDAAPSQVRPREPMSVLMMAN
REVVNTEMGSYRDSAENEECSQPMDDIQVNMMTLAEHIIEATPDRIKQENFVPMESSALE
RTDTAAISSTMSWLASYLADVDHLPNAAQIRSAYNEPLTPSSNTSLSPVGSPVSEIAFEK
PSLPSAADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQ
QEVAAAVIQRCYRKYKQLTWIALKYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVL
IQKYYRSYKKCGKRRQARRTAVIVQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHR
LYKRSERIEKGQGT
Download sequence
Identical sequences F6VVK0
ENSECAP00000018557 9796.ENSECAP00000018557 ENSECAP00000018557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]