SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018571 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018571
Domain Number 1 Region: 719-995
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-78
Family Protein kinases, catalytic subunit 0.000000000684
Further Details:      
 
Domain Number 2 Region: 50-217
Classification Level Classification E-value
Superfamily L domain-like 5.1e-42
Family L domain 0.000000564
Further Details:      
 
Domain Number 3 Region: 340-528
Classification Level Classification E-value
Superfamily L domain-like 2.44e-40
Family L domain 0.000000453
Further Details:      
 
Domain Number 4 Region: 514-645
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.14e-21
Family Growth factor receptor domain 0.000000196
Further Details:      
 
Domain Number 5 Region: 192-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.53e-17
Family Growth factor receptor domain 0.0000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018571   Gene: ENSECAG00000020409   Transcript: ENSECAT00000022466
Sequence length 1258
Comment pep:known chromosome:EquCab2:11:22684372:22706648:-1 gene:ENSECAG00000020409 transcript:ENSECAT00000022466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTMELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQ
GNLELTYLPASASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVL
DNGDLLDNATSATGAVPGGLRELQLRSLTEILKGGVLIQRNPQLCHQDTILWEDIFHKNN
QLTLTLIDTNRSRACQPCSPACRPSHCWGESSEDCQNLTRTVCAGGCARCKGPRPTDCCH
EQCAAGCTGPKHSDCLACLHFNHSGICELHCPSLVIYNTDTFESMPNPEGRYTFGASCVT
ACPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVT
SANIQDFAGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPD
SLPDLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLQELGSGLALVHHNARLCFV
HTVPWAQLFRNPHQALLHSANRPEDECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRG
QECVEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACTHYKDPPFCV
ARCPSGVKPDLSFMPIWKFPDEEGTCQPCPINCTHSCLDLDDRGCPAEQRASPVTSIIAA
VVGILLVVVIGLVLGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKE
TELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV
GSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLE
DVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRR
RFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDL
VDAEEYLVPQQGFFCPDPAPGAGGTAHRRHRSSSSRSGGGELTLGLEPSEEEPPKSPLAP
SEGAGSDVFDGDLGMGAAKGLQSLPQHDPSPLQRYSEDPTVPLPPETDGYVAPLSCSPQP
EYVNQPEVRPQPPSPLEGPLSPCRPDGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYL
APRSRAAPQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDVPV
Download sequence
Identical sequences F6VNY4
ENSECAP00000018571 9796.ENSECAP00000018571 ENSECAP00000018571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]