SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018660 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018660
Domain Number 1 Region: 130-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018660
Domain Number - Region: 96-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018660   Gene: ENSECAG00000021209   Transcript: ENSECAT00000022573
Sequence length 302
Comment pep:known chromosome:EquCab2:Un0153:7602:15426:1 gene:ENSECAG00000021209 transcript:ENSECAT00000022573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDFGGGNTAWEEKTLSKYEFSEVRLLEIMESLCGSSDFECNRLVEEQEEHLEAWWLRLKK
EHPDLFEWFCVKTLQVCCYPGTYGPDCLACQGGSERPCSGNGHCSGDGSRQGDGSCQCHI
GYQGVLCTDCTDGYFSSLRNETHSICTACDESCKTCTGPTNRDCAQCEVGWVREDGACVD
VDECAAEPPPCGEKQYCQNANGSFVCEECDSTCVGCTGKGPGQCKECIPGYTKESGQCTD
IDECSLAEKACVRENENCYNTPGSYVCVCPEGFEETEDACVQTQTAEVTQESPTELPSRE
DL
Download sequence
Identical sequences H9H012
ENSECAP00000018660 9796.ENSECAP00000018660 ENSECAP00000018660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]