SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018726 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018726
Domain Number 1 Region: 135-247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 243-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 34-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000129
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018726
Domain Number - Region: 281-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00021
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018726   Gene: ENSECAG00000021047   Transcript: ENSECAT00000022647
Sequence length 443
Comment pep:known chromosome:EquCab2:12:25949220:25955000:-1 gene:ENSECAG00000021047 transcript:ENSECAT00000022647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFASCLPGSLLLWALLLLLLGAASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCLAGYEPDDQES
CVDVDECAQDLHDCRPSQECHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences F6T962
ENSECAP00000018726 XP_001494662.3.31192 XP_014700300.1.49734 ENSECAP00000018726 9796.ENSECAP00000018726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]