SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018748 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018748
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000741
Further Details:      
 
Domain Number 2 Region: 428-584
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.16e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000711
Further Details:      
 
Domain Number 3 Region: 644-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-35
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 146-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-33
Family Spermadhesin, CUB domain 0.00000113
Further Details:      
 
Domain Number 5 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018748   Gene: ENSECAG00000020753   Transcript: ENSECAT00000022671
Sequence length 922
Comment pep:known chromosome:EquCab2:29:4699297:4839431:1 gene:ENSECAG00000020753 transcript:ENSECAT00000022671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLLCAALALALALAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENENGRLWGKFCGKIAPSPIVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIIFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSILQSGVSEDFRCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRI
DISSNGEDWITIKEGSKPVIFQGNTNPTDVVFGVFPKPLITRFVRIKPLTWETGISLRFE
VYGCKMTDYPCSGMLGMVSGLISDSQITASNQEDRNWMPENIRLVTSRSGWALPPAPHPY
INEWQVDLGEEKIVRGVIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFE
GNNNYDTPELRTFPPLSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVD
ECDDDQANCHSGTGDDFQLTGGTTVLTTEKPTVLDSTIQSEFPTYGFNCEFGWGSHKTFC
HWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHC
MTFWYHMSGTHVGTLRVKLHYQKPEDYDQLVWMAIGHQGDHWKEGRVWLHKSLKLYQVIF
EGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPESKIDETGSTPGYEGTGGGDE
NISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNF
ELVDGVKLKKDKLNTQSSYSEA
Download sequence
Identical sequences F6T858
ENSECAP00000018748 ENSECAP00000018748 9796.ENSECAP00000018748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]