SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018811 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018811
Domain Number 1 Region: 14-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.24e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 206-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000709
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 114-171
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000291
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018811   Gene: ENSECAG00000021255   Transcript: ENSECAT00000022745
Sequence length 316
Comment pep:known chromosome:EquCab2:25:6996844:7053596:1 gene:ENSECAG00000021255 transcript:ENSECAT00000022745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFL
RRAACKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAE
NVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDASLL
GKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESG
YTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQ
KQNLGHFTSDTSSRMV
Download sequence
Identical sequences F6QZ52
ENSECAP00000018811 9796.ENSECAP00000018811 ENSECAP00000018811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]