SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018862 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018862
Domain Number 1 Region: 994-1092
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000228
Family Canonical RBD 0.0068
Further Details:      
 
Domain Number 2 Region: 72-109
Classification Level Classification E-value
Superfamily SAP domain 0.00000256
Family SAP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018862   Gene: ENSECAG00000021097   Transcript: ENSECAT00000022804
Sequence length 1341
Comment pep:known chromosome:EquCab2:1:161238784:161270290:-1 gene:ENSECAG00000021097 transcript:ENSECAT00000022804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRRKYPSSSGGIRGVLSGNRGVDYGSGRGRLSTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVA
SLLPPDFQSSLERPELELSRHSPRKSSSVSEEKGESDDEKPRKGERRSSRVRQARAAKLS
ECSQVVEEEEHQETPSRNLRVRADRNLKTEEEEEEEEEEEEEEEDEETDEGHKSRDAPVL
KQFKKEEEEEMPIAKPEEMMDERPQTIRSQEQEGLERGGRVTRSQEEARRSHLARHQQEK
EMKTAAPLEEEERAIKSSKGLEEKSKSPSPPRLTEDLEKTPLVLQPEQTASEEETPPPLL
TKEASSPPPNTQLQSEEETEPMEGPAPPVLVQLSPPNTDAEARELLISQHTVQSVGGLSP
LSSPADTKAESPVEKVPEERVLPLVQKSTLAESSAQKGLETESEKSAQPLPLKFEELAPS
KGIPEQSLKQPSLEQKEGRRASHTLLPSHRVKRSADSSSSRSSSSSSSSSRSRSRSPDSS
GSESHSPLRSKQRDVSRARTHANPCGRSKMGSRSTSESRSRSRSRSRSASSNSRKSLSPG
VSRDSSTSYIETKDPSSGQEVATPPVPQLQVLEPKERTSASSSIRVRRMSQPEPAEKRVT
QRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSRLPESERSHHTVEEKEEVTMETSENR
PENEVPEPPMPSADQVSNDDRPEGSAEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDT
EGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISED
ETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPIPPQVSVEVAL
PPPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLV
RPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPK
FLCADYAEQDELDYRRGLLVDRPSETKTEEQGVPRPLHPPPPPPAQPPQHPRAEQREQER
AVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE
KAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQ
KEREKEAERERTRQLEREKRREHSRERDRERERDRERDRGDRERDRERDRERGRERDRRD
TKRHSRSRSRSTPVRDRGGRR
Download sequence
Identical sequences F6S4Y2
ENSECAP00000018862 ENSECAP00000018862 9796.ENSECAP00000018862 XP_003363595.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]