SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018879 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018879
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 177-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000335
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018879   Gene: ENSECAG00000021343   Transcript: ENSECAT00000022821
Sequence length 643
Comment pep:known chromosome:EquCab2:27:11939371:12148884:-1 gene:ENSECAG00000021343 transcript:ENSECAT00000022821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKERGSGRKPAPAEGGPSPALPPRLKEMKSQESVAGSKLVLRCETSS
EYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASVTDSGEYMCKVISKLGND
SASANITIVDSNEIFTGMPASTETAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVK
CAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
ELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMVNIANGP
HHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTSTAHHSTTVTQTPSHSWS
NGHTESIISESHSVIMMSSVENSRHSSPTGGPRGRLNGMGGPRECNSFLRHARETPDSYR
DSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSTTVSMPSMAVSPFVEEER
PLLLVTPPRLREKYDHHPQQFNSFHHNPAHESNSLPPSPLRIVEDEEYETTQEYEPAQEP
VKKLTNSRRAKRTKPNGHIANRLEMDSNTSAESSNSESETEDERVGEDTPFLGIQNPLAA
SVEAAPAFRLADSRTNPAGRFSTQEELQARLSSVIANQDPIAV
Download sequence
Identical sequences F6RG52
ENSECAP00000018879 ENSECAP00000018879 XP_005606393.1.31192 9796.ENSECAP00000018879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]