SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018943 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000018943
Domain Number - Region: 228-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 363-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0653
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018943   Gene: ENSECAG00000021192   Transcript: ENSECAT00000022895
Sequence length 1040
Comment pep:known chromosome:EquCab2:5:41405842:41416239:-1 gene:ENSECAG00000021192 transcript:ENSECAT00000022895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLHSLLLLALGLGLAGTLNPNDPNTCSFWESYTTTTKESHTRPFSLLPSEPCDRPWE
SPHTCPRPTVVYRTVYRQVVKTDHRRRLQCCRGFYESSGACVPLCAQECVHGRCVAPNQC
QCVQDWRGDDCSSACAPGMWGPQCDMPCSCGNSSSCDPKSGACSCPSGLQPPHCLQPCSP
GRYGPACQFSCQCHGAPCDPHTGACFCPPERTGPSCEVSCHQGTVGFSCPSTHPCHNGGV
FQASQRSCSCPPGWMGTICSLPCREGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGD
RCREECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTGDRCAERLCPDGLYGLSCQ
VPCTCDPEHSLSCHPMSGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQPDS
GLCRCAPGYTGPHCASLCPPDTYGVNCSVRCSCENAIACSPIDGTCVCKEGWQRGNCSVP
CLPGTWGFGCNASCQCAHEAACSPQTGACTCTPGWHGVHCQLPCPKGQFGEGCASRCDCD
HSDGCDPVHGHCQCQAGWTGARCHLPCPAGFWGVNCSNTCTCKNGGTCIPENGNCVCAPG
FRGPSCQRPCQPGRYGKRCVPCKCANHSSCHPSDGTCYCLAGWTGPDCSQPCPLGHWGAN
CAQPCQCRHGGTCHPQDGSCFCPPGWTGHLCLEGCSPGTFGANCSQACQCGSGERCHPET
GACVCPPGHSGAPCRIGDQETFTIMPTSPVAYNSLGAVIGIAVLGSLVVALVALFIGYRH
WQKGKEHQHLAVAYSSGRLDGSEYVMPDIPPSYSHYYSNPSYHTLSQCSPNPPPPNKVPG
GQLFASLQAPERPGGAHGHDNHATLPADWKHRREPPPGSLDRGGSGPKPSYSCSYSNSNG
PGPFYSKGPISEEGLGASMASLSSENPYATIRDLPSLLGSPRESSYVEMKGPPSGSPPRK
LPQLRNSQRQRHTQPQRDSGTYEQPSPLTHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPG
HYDLPPVRHPPSPPLRRQDR
Download sequence
Identical sequences F6Q970
ENSECAP00000018943 ENSECAP00000018943 9796.ENSECAP00000018943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]