SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018951 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018951
Domain Number 1 Region: 1555-1731
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.31e-31
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 1386-1549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-28
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 982-1155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-20
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 1155-1325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-19
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 783-975
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000137
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 6 Region: 83-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018951
Domain Number - Region: 255-338
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0086
Further Details:      
 
Domain Number - Region: 497-718
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0123
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Domain Number - Region: 341-534
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0419
Family DNA repair protein MutS, domain III 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018951   Gene: ENSECAG00000021277   Transcript: ENSECAT00000022904
Sequence length 1732
Comment pep:known chromosome:EquCab2:8:45557141:45633523:1 gene:ENSECAG00000021277 transcript:ENSECAT00000022904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGHLGTRMPPAVRWSAGWLWIFGAALGQCLGYDSQQQRVVFLQPPGQSHLQASYSEFKP
SQGCSPGYYRDNKGLYTGRCVPCSCNGHSHRCQDGSGICINCQHNTAGNHCERCKEGHYR
NAVQGSCMVCPCPHSNRYWLGWGVGGKWEVTAKAKLSGINHECAPGYFGNPQKFGGSCQP
CNCNNNGHLGSCDPVTGDCINQEPKDDGPGEECDDCDSCVMTLLNDLATMEGELRLVKSQ
LQGLSASASTLEHMRHLETQTKDLRNQLLNYRSAISNHGSKMDGLEKELSNLNHEFETLQ
EKVQINSRKVQALPNNVDRTTQRAKELDTKIKNVIRNVHILLKQQFSGTNGEGNNVLLGD
FSRELAEADRMMRELRSRNFGKQLKDAEDGKKNAQLLLNRIRSWLEKHQVENSGLVKSIR
DSLNEYEAKLTDLRAMLQEAATQAKQAAGLNRENQKTLESIKRQVKEMNSLQSDFNKYLA
TADASLLQTSAVLQLMRKSQEEYEKLAASLNEAKHELRDKVKELSKSSSKTSLVVAAEKH
AQSLQELAKQLEEIKRNTSGDELVRCAVDAATAYENILNAIKAAEDAADKATSASESAHQ
TVIKENLPRKAKTLSSNSEKLLNEAKITQKKLQQEISPALNNLQQTLKIMTVQKGLIDTN
ITTIRDDLRGIQRGDIDGMINSAKSIVRNANDITNEVLDGLTPIQTDVERIKDTYGSTQS
EDFNKALGDADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAAN
KVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPDSRENGGTNNMFVMYLGKKDAS
RDYIGMAVVDGQLTCVYNLGEREAELQVDQILTESETQESVMDRVKFQRIYQFARLNYTK
KATSSKPEATQPHDMDSGNSNTLLNLDPENAVFYVGGYPPDFRLPSRLRFPPYKGCIELD
DLNENVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPLPIFVQT
IQTTVDRGLLFFAENQDHFISLDIEDGSLLVRYKLNSESPEEKGIRVIINDGKDHSIQIR
IGKAQKLMRISVAREDIKINGEIFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLKKTT
GVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQMSFTNLDFPLPSLFQASFGFQTFQPGGI
LLHHQTRTSSLQVTLEDGHIELSTTDSSSPIFKSPQTYMDGLLHYVSVISDTSGLRLLID
DQPLKNNQRLQGFSGSQQSLRLGGSHFEGCISNVFVHRSSQSPAVLDLASKSTKREVSLG
GCSLNEPPFLMLLKGSTRFNTAKTFSINQASPLQDTPVASPRSKERWRDAQSCPSPPKAQ
ASHGALRFGDSPTSHLLFTVPQELLKSRSRFAVDVQTTSSRGLMFYTGTRNSFMALYLSK
GRLVFALGAEGKKLKLKSKEKFNDGKWHTVAFGQDGEKARLVVDGLRAREGSWPRSFTVS
LRVPVYLGSPPSEKSKSLPQSSFVGCLRNLQLDSKPLATPSVSFGVSPCSHGSLEKGIYF
SQEGGHIILANSVLLGPEFKLVFSIRPRSLTGILIHIGSQRGKHLCVYMEAGKVTASVDS
EAGGILTSVTPKRSLCDGQWHRVAVTIKKHILHLELDTENSYTAGQLPFPPASAREPLHI
GGVPANLQTLKLPVWKSFFGCVKNVQVNHIPVPVTEAVEVQGTVSLNGCPDH
Download sequence
Identical sequences F6Q8N4
ENSECAP00000018951 9796.ENSECAP00000018951 ENSECAP00000018951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]