SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019012 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019012
Domain Number 1 Region: 441-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 620-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000161
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019012
Domain Number - Region: 717-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000161
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 813-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000699
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 749-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 477-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 685-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00283
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 653-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00292
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 781-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019012   Gene: ENSECAG00000021577   Transcript: ENSECAT00000022977
Sequence length 849
Comment pep:known chromosome:EquCab2:4:45306021:45341212:-1 gene:ENSECAG00000021577 transcript:ENSECAT00000022977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWDRQRRWKRQSLYEFPPFFAFQSLSQSDLEEFAYFFPEDHAEDVHQEFVPTWPTPSGL
TEYSTLELCQQKLANSSVGRRCLAFLGKRLDSVIDMCVKDVLLKDDLSWAEAGVALLENE
CEKRILEEGRLNTEEYGRSMEDILLVLKCPNLCSGNGQCMEWGCACSPGFSSYDCSDSHD
KAPEIIELENAGFCNVRKYNCMMVRVFGQGFKESPSFKCEVTKLQYNSSKWVLGEAVYAH
TVFQNSRTVDCQLPADVQQSGTMDLMGEKPIVKWQLKVSNDGYRFSNPKIMIIYDGACQV
CGLYEKDSCTIKENVCIIDGLCYIEGDKNPARTCLICRPKISKFTWSILENNQPPVIQIP
QDKLQTFYGENLVYQFVAFDPEGSDIHFALDSGPEGANVSSAGLLMWKSESQTPQRFTLR
LNDDCNAESRAVIEVTVRSCDCLNGGSCVSDIKFPPGSGAYLCVCLPGFQGGLCEVEVTE
CQSNPCGLGRCIRGFHSYSCDCPPEFKVETQFLNEFTTHTVVHTRSEKSVTKEEDGENAT
QKERHVKPTNGNASTICRHPCGKSRECVAPNVCKCKTGYAGSNCQTALCHPDCKNHGKCI
KPNVCECPPGRGGATCDEEHCSPPCLHGGTCLAGNLCTCPYGFVGPRCETMVCNRHCENG
GECLTPDVCLCKPGWYGPTCSTALCDPVCLNGGSCNKPNTCLCQNGFFGAQCQNAICHPP
CKNGGHCMRNNVCTCREGYTGRRCQKSICDPMCMNGGKCVAPNICSCPSGWIGKQCGTPI
CFQKCKNGGECIAPNVCHCPASWEGVQCQIPICNQKCLYGGRCVFPNVCSCRTGYSGDKC
EKKIQIKRH
Download sequence
Identical sequences F6XK73
ENSECAP00000019012 9796.ENSECAP00000019012 ENSECAP00000019012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]