SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019016 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019016
Domain Number 1 Region: 430-655
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000391
Family HEAT repeat 0.051
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000623
Family APC10-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019016   Gene: ENSECAG00000021352   Transcript: ENSECAT00000022981
Sequence length 925
Comment pep:known chromosome:EquCab2:2:46276385:46311156:1 gene:ENSECAG00000021352 transcript:ENSECAT00000022981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQ
LLAHQYMISSKIEFYISESLPEYFVPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHQNHVNKYNVYNQVALVAINIIGDPADFSDDSNITSREKLIDHYLGHNTED
PALEGSCAGKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYRAKVYEQLELHSLADAELMRR
PFDSPLQPLVHSGSPRHQPATLSLPQQEERVTENRFADPFPQEKPSSHSLDISPQHPTGD
WAPPTIDPPRRTHLESLPYDERPLPAVRKQPGAAAVGPEKSDGDVSEGPRAGAAGDPEPL
TEKALREASSAVDVLGEALVAGAYSKTWSHREDALLALYKQLMEMPVGTPKEDLKSTLRA
SVFLIRRAIRDIVTPVFQASLKLLKMIITQYIPKHKLSKLETTHCVERTIPILLTRTGDS
SARLRVIASNFVQEMALFKEVKSLQIIPSYLVQPFKAKSSPHVALSQVALLARLLRDLGL
ECSGLTADSVMKFSVSALEHRVYEVRETAVTIILDMYKQHGASVLEYLPPDDSTTRKNVL
YKTIFEGFAKIDGRPTDAEIRAQKKAATEEAEKRKKEEIKALQGQLAALREMQAEVQEKE
SDAVKAKNQDTQGRKAAPPDAAEIPDNHYLDNLCIFCGERSDSFTEEGLDLHYWKQCLML
TRCDYCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAILKEELPRHIKMKDCNPAKSEK
LANRCPLCHENFTPGEEAWKAHLMGPAGCTMNLRKTHVLHTAPTLPLGKSPAVTKSGTSG
PKAGSKIPTPKGGLSKGSGRTYTKR
Download sequence
Identical sequences F6XK23
ENSECAP00000019016 XP_001497410.1.31192 ENSECAP00000019016 9796.ENSECAP00000019016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]