SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019147 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019147
Domain Number 1 Region: 423-735
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000157
Family Galacturonase 0.051
Further Details:      
 
Domain Number 2 Region: 773-837,870-962
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000201
Family Pectate transeliminase 0.062
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019147
Domain Number - Region: 270-335
Classification Level Classification E-value
Superfamily Nitrogenase accessory factor-like 0.0314
Family Nitrogenase accessory factor 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019147   Gene: ENSECAG00000021484   Transcript: ENSECAT00000023128
Sequence length 1383
Comment pep:known chromosome:EquCab2:23:19283269:19351850:1 gene:ENSECAG00000021484 transcript:ENSECAT00000023128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHATDSRGRSPAFLQPQNGNSHRSSGYVPGKVVPLRPPPPPKSQASAKLTSIRQEARATF
AFSPEEQQAQRESRKQKRHKNTFICFAITSFSFFVALAIILGISSKYAPDENCPDQNPRL
RNWDPGQDSAKQVVIKEGDMFRLTSDATVNSVVIQDGGLLVFGDDKDGSRNITLRTRYIL
IKDGGALHIGAEKCRYKSKATIALYGRSDEGESMPTFGKKFIGVEAGGTLELHGAQKTSW
TLLTRTLHSSGLTFGSYAFEKDFSRGLNVRVIDQDTAKILESERFDTHEYHNESRRLEEF
LRVQDPGRIVAIAVGDSAAKSLLQGTIQMIQDRLGSNLIQGLGYRQAWALVGVIDGGNTS
CNESVRNYENHSSGGKALAQREFYTVDGQKFAVTAYSEWIEGVSLSGFRVEVMDGVKLHL
LDDVSSWKPGEQIVVASTDYSMYQAEEFTLLPCPECSPFQVKVKETPQFLHMGEIVDGVD
MRAEVGILTRNVVIRGEMEDSCYAENQCQFFDYDTFGGHVMVMRNFTSVHLSYAELEHLG
QQHLGRYPVHFHLCGDVDYKGGYRQGTFVDGLSIHHSFSRCITVHGTNGLLIKDTIGFDT
LGHCFFLEDGVEQRNTFFHNLGLLTKPGTLLPTDRNNSMCTAMREKVFGNYVPVPATDCM
AVSTFWIAHPNNNLINNAAAGSQDAGIWYLFHKEPTGESSGLQLLAKPELTPLGIFYNNR
VHSSFKAGLFIDKGVKTTTASAADPREYLCLDNSARFRPHQDADPEKPRAAAVIDRLIAF
KNNDNGAWVRGGDIVVQNSAFADNGIGLTFASDGSFPSDEGSSQEVSESLFVGESRNYGF
QGGQNKYVGTGGIDQKPRTLPRNRTFPIRGFQIYDGPIHLTKCTFKKYVPTPDRYTSAVG
FLMKNSWQITPRNNISLVKFGPHVSLNVFFGKPGPWFEDCELDGDKNSIFHDVDGSVTGY
KDAYVGRMDNYLIRHPSCVNMTKWNAVICSGNYAQVYVQTWSTQNLTMTIARDEYPSSPM
VLRGINQKAAFPQYQPVIMLEKGYTVHWNGPAPKIAFLYLINFNKNDWIRVGLCYPSNTS
FQVTFGFFQRHNGSLSKMEEYEPVHSLAELQKKQSERKFYFDSGTGLLFLYLKAKSHRIG
HSYCSSQGCERVKIQATTDSKAISNCMAKAYPQYYKKPSALKRMPSMLTGLCQGCGTQQV
VFTSDPHESYLPVQFQSPSKAELQRGAPSVISVNGTDFTLRSAGVLLLIVDACGVPFRLT
EKKIFSLADVSRMEEYLKAGIPPRSVVLLSTRGEIKQLNISDSLVPLGLAKPAHLYNKGF
TIFLGFSGNFKPSWTKLFTSPAGQGLGLLEQFIPLQLDEYGCPRAGTVRRRDLELLKQLQ
KHI
Download sequence
Identical sequences F6Z4U0
ENSECAP00000019147 9796.ENSECAP00000019147 ENSECAP00000019147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]