SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019160 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019160
Domain Number 1 Region: 2232-2384
Classification Level Classification E-value
Superfamily CalX-like 1.24e-30
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 2 Region: 2960-3090
Classification Level Classification E-value
Superfamily CalX-like 3.66e-29
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 3 Region: 3927-4071
Classification Level Classification E-value
Superfamily CalX-like 2.49e-28
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2117-2247
Classification Level Classification E-value
Superfamily CalX-like 2.49e-27
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 5 Region: 2597-2715
Classification Level Classification E-value
Superfamily CalX-like 3.14e-27
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 6 Region: 1004-1133
Classification Level Classification E-value
Superfamily CalX-like 4.05e-27
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 7 Region: 1726-1812,1840-1875
Classification Level Classification E-value
Superfamily CalX-like 1.57e-26
Family CalX-beta domain 0.00055
Further Details:      
 
Domain Number 8 Region: 145-289
Classification Level Classification E-value
Superfamily CalX-like 1.7e-25
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 9 Region: 4401-4531
Classification Level Classification E-value
Superfamily CalX-like 1.83e-25
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 10 Region: 4266-4410
Classification Level Classification E-value
Superfamily CalX-like 1.83e-25
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 11 Region: 774-926
Classification Level Classification E-value
Superfamily CalX-like 2.35e-23
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 12 Region: 1130-1281
Classification Level Classification E-value
Superfamily CalX-like 2.44e-23
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 13 Region: 3585-3665
Classification Level Classification E-value
Superfamily CalX-like 2.49e-23
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 14 Region: 404-551
Classification Level Classification E-value
Superfamily CalX-like 3.4e-23
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 15 Region: 4658-4799
Classification Level Classification E-value
Superfamily CalX-like 1.22e-20
Family CalX-beta domain 0.0073
Further Details:      
 
Domain Number 16 Region: 1988-2130
Classification Level Classification E-value
Superfamily CalX-like 1.96e-20
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 17 Region: 1326-1517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-20
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 18 Region: 1585-1714
Classification Level Classification E-value
Superfamily CalX-like 4.1e-20
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 19 Region: 1880-1986
Classification Level Classification E-value
Superfamily CalX-like 4.19e-20
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 20 Region: 3668-3813
Classification Level Classification E-value
Superfamily CalX-like 4.19e-19
Family CalX-beta domain 0.0064
Further Details:      
 
Domain Number 21 Region: 5003-5129
Classification Level Classification E-value
Superfamily CalX-like 6.02e-19
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 22 Region: 5221-5377
Classification Level Classification E-value
Superfamily CalX-like 1.44e-18
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 23 Region: 4051-4181
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.004
Further Details:      
 
Domain Number 24 Region: 2348-2393,2495-2573
Classification Level Classification E-value
Superfamily CalX-like 2.09e-18
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 25 Region: 886-1003
Classification Level Classification E-value
Superfamily CalX-like 3.53e-18
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 26 Region: 2822-2957
Classification Level Classification E-value
Superfamily CalX-like 9.81e-18
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 27 Region: 2703-2838
Classification Level Classification E-value
Superfamily CalX-like 6.54e-17
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 28 Region: 3094-3205
Classification Level Classification E-value
Superfamily CalX-like 1.83e-16
Family CalX-beta domain 0.0065
Further Details:      
 
Domain Number 29 Region: 666-783
Classification Level Classification E-value
Superfamily CalX-like 2.35e-16
Family CalX-beta domain 0.0086
Further Details:      
 
Domain Number 30 Region: 264-399
Classification Level Classification E-value
Superfamily CalX-like 3.92e-16
Family CalX-beta domain 0.006
Further Details:      
 
Domain Number 31 Region: 5499-5646
Classification Level Classification E-value
Superfamily CalX-like 7.46e-16
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 32 Region: 39-154
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000196
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 33 Region: 3775-3910
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000327
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 34 Region: 4171-4275
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000327
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 35 Region: 4538-4650
Classification Level Classification E-value
Superfamily CalX-like 0.00000000196
Family CalX-beta domain 0.0052
Further Details:      
 
Domain Number 36 Region: 5369-5507
Classification Level Classification E-value
Superfamily CalX-like 0.0000000392
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number 37 Region: 4762-4868
Classification Level Classification E-value
Superfamily CalX-like 0.000000103
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number 38 Region: 515-629
Classification Level Classification E-value
Superfamily CalX-like 0.00000131
Family CalX-beta domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019160
Domain Number - Region: 3211-3248
Classification Level Classification E-value
Superfamily CalX-like 0.0497
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019160   Gene: ENSECAG00000021057   Transcript: ENSECAT00000023148
Sequence length 5956
Comment pep:known chromosome:EquCab2:14:77057931:77302636:-1 gene:ENSECAG00000021057 transcript:ENSECAT00000023148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSPGPGMSSASLLVNLLLALLICFVFGETEIRFGGQTEFVVNETSTTVIRLVIERIGE
PANVTAIVSLYGDDTGDFFDTYAAAFIPVGETNRTVYIAVCDDDLPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMPFSVMVSEPRGRNESVPLTLIREKGTYGM
VTVTFEVEGGPNPPEEDLSPVKGNITFPPGKATVVYNLTVLDDEVPENDEMFLIQLKSVE
GGADINTSRNSVEIIIKKNDSPVSFIQSVYLVPEEDHILLIPVVRGKDDNGNLIGSDEYE
VLINYVIITGNSTAHAQQNLDFIDLQPNTTIVFPPFIYESHLKFQIVDDTIPEIAESFHV
VLLKDTLQGDAVLLSPSIVQVTIKPNDKPYGVLSFNSILFERAVVIDEDTTSRFEEITVV
RNGGTHGNISVNWVLTRNNSDPSLVTADIRPSSGVLHFAQGQMLATIPLTVVNDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPVENQKIESSPGERYLSLS
FTRLGGTKGDVKMFYSALYIPAGAVDPLRAKDGILNISRRNSLIFPEQKTHVTTKLPIRN
DAFLQNGAHFLVQLETVELVNIIPPIPPISPRFGKIRNISLVVTPEIANGEIGFISNLPI
ILHEAEDSTAEVVYIPLHRDGTDGQATVYWSLKPSGFNSKAVTLDDISPFNGSVVFLSGQ
SDTTINITVKADDIPEMNETVTLSLDRVNVENQVLKSGYTSRELIILENDDPGGVFEFSP
ASRGPYVIKEGESVELHITRSRGALVEQFLRYCVEPGESNEFYGNTGVLEFKPGEREIVI
TLLTRLDGIPELDEQYWVVLSSHGERESKLGSATVVNITILKNDDPHGIIEFVSDDLIVM
INESKGDDTYSAVYGVIRNRGNFGHVSASWVVSPDFTQDVFPVQGTIFFGDQEFLKHITV
YSLPDEIPEEMEEFTITLLNATGGAKIGNKTAATLRIRRNDDPIYFAEPRVVRVQEGETA
DFIVLRNGSVDVACTVQYATMDGKATASKGDFVPIEKGETLVFAVGSREQNISVFINEDD
IPETDEPFYIILFNSTGDTVVYQYGIATVIIEANDDPNGIFSLEPVDKAVEEGKTNAFWI
LRHRGHFGNVSVAWQLFQNDSALQPGQEFYETSGTVNFMDGEAAKPIILHAFPDKIPEFN
EFYILKLVNISGGSPGPGGQLAGTNLQVTVMIPFNDDPFGVFTLDPECLEREVAEDVLSE
DDMSYITNFTILRQQGDFGDVRVGWEILSSEFTAGLPPMIDFLLVGVFPSTVHLQPHMRR
HHSGTDALYFSGLEGAFGTVNPKYHPSRNNSIANFTFSAWVMPNANTNGFVIAKDDGNGS
IYYGVKIQTNESHVTLSLDYKTLGSNATYIAKTTVVKYLEESVWLHLLIILDDGIIEFYL
DGNAMPRGIKSLKGEAIADGPGTLRIGAGVNGSDRFTGLMQDVRSYERKLTLEEIYELHA
MPAKSDLHPVSGYLEFRQGETNKSFIISARDDNEEEGEELFILRLVSVYGGARISEENTT
ARIIIQKSDNANGLFGFTGACIPEIAEEGSTISCVVERTRGALDYVHVFYTISQIESDGI
NYLVDDFANASGTITFLPWQRSEVLNIYVLDDDIPELNEYFRVTLVSAIPGDGRLGSTPT
SGASIDPEKETTDVTIQASDHPYGLLQFSTGRPPQPEDTMTLPASGVPHVTVQEEDGEVR
LLVVRAQGLLGRVMAEFRTVSLTAFSPEDYQGIAGTLEFQPGERYKYISVNITDNSIPEL
EKSFKVELLNSEGGVTELFRVDGSGSGDGDKEFFLPTIHKHASLGVASQILVTIAASDHA
HGVFEFSPESLFVSGTEPEDGYSTVVLNIMRSHGALSQVTLLWSVDSDPDGDLAFTSGNV
TFEIGQKSANITVEILPDEEPELDKAFSVSILSVSSGSLGVHTNATLTVLASDDPCGVFI
FSEKSRPVKVEEANQNITLSIIRLKGLLGKVIVTYATLDDMEKPPYFPPNLARATQGRDY
IPASGFALFKANQSEATITISILEDDEPERSESVFVELLNSTLAEQVQNRPISNSPRLGP
KVETIAHLIIIANDDAFGTLQLSAPVVRVAENHVGPIINVTRTGGAFADVSVKFKAVPIT
AIAGEDYSIASSDVVLLEGETSKAVPIYIINDIYPELEESFLVQLLNETTGGAKLGALTE
AIIIIEASDDPYGLFGFQITKLIVEEPEFNSVKVNLPVIRNSGTLGNVTVQWVATINGQL
ATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLDRVANI
IIPANDNPYGTVAFVQSVYHVQEPLERSSCANITVRRSGGHFGRLLLFYRTSDIDVVALA
VEEGQDLLSYYESPIQGVPDPLWRTWVNVSAVGEPQYTCAALCLKEHACSAFSFFSASEG
PQCFWMTSWISPTVNNSDSWTYRKNLTRVASLFSGQAVAGSDYEPVTRQWAIMLEGDEFA
NLTVSVLPDDFPEMDESFLISLLEVHLMNITASFKNQPTIGQPNTSTVVIALNGDAFGVF
VIYSTSPNTSEDGLYVEVQEQPQTTVKLMIHRTGGSLGQVTVEWRVVGGTATEGLDFIGA
GDVLTFAEGEIKKTAILTILDDSEPEDDESIIVSLVYTKGGSRILPSSDTVRVNILANDN
VAGVVSFQTTSRSVIGHEGEILQFHVIRTPPGRGNVTVTWKIIGKNLELNFANFTGHLFF
PEGSLNQTIFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAAVLTVEASD
EPHGVLNFALSSRFVLLQEANITIQLFINREFGSLGAINVTYTTVPGVLSLKNQTEGNLA
EPDVDFVPVVGFLILEEGETAAAINITILEDDVPELEEYFLVNLTYVELIMAPFTSFPPR
LDSEGLTAQIIIDANDGARGVIKWQHSRFEVNETQGRFALVAQRSKGALGHVSLFVYAQN
LEAQLGLDYIFTPMILHFANGERYKNVDIMILDDDIPEGDETFQLILTNPSPGLELGGNT
IALITVLANDDGPGVLSFNNSEHFFLREPTALHVQESVAVLHIVREPAQGLFGTVAVQFI
VTEVNSSMESKDLTPSKGYIVLEEGVRFKALHISAILDTEPEMDEHFVCTLFNPTGGARL
GMRVQTLITVLQNQAPLGLFSISAVANRGTSVDIEEANRTVYLNVSRTNGIDLAVSVEWE
TISETAFGMRGMDVMFSKFQSFLNASASGWCFFTLEDSIYGVMLRKLSSTVYRWQGIFVP
LEDLNIENPKTCEAFNIGPSPFFVITHEERNEDKPSVNSVYTFTSGSKLFLVQTIVISES
SQVRYFTSDSQDYLIVASQRDDSELTQVFRWDGASFLLRQTLPVRGVLSMALFTRAGSVF
LAISQAKAGPNALLLRWSGNEFINFQEVPISGTTQVEALTSGDDIYLIFAKPVFLGDQNS
IDIFIWETGQSSFRYFQSLDFAAINRIYSFTPASGIVHILLIGQAVSALYCWNSELNQFS
FILEAPSARDAASVTVKSLNSGKNLIALAESTHSHIYELAYISSQSDFVPSSGELVFEPG
DTEAVIAVNILDDTVPEEEESFRVQLKNPKGGAEIGINGYVKITILSNDDAYGVVGFAQN
SLYKQVEEMEQDNLVTLNVERIKGTYGHITVAWEAGGSVSDIFPTSGVISFSEGQALSAV
TLTVLADDVPEVSETVIITLTSITTEGVEDPSKGATIDQKRNKSVITALPNDSPYGLVGW
RAESLFIRVAEPKENVSILQLHIVRDKGLLGDIAIHLIAKPNFSLHVHNRATENEDYVLQ
ETIIIMKENVKEAHAKVAILPDDVPELEEGFLVNITEVYLVNSDFSAGQPSVRRPGMETV
EIMIEENDDPRGIFKFHVARDVGGVITAYEVPPPLNVLQVPVVRLAGSFGVVNVYWKATL
ESAALEDFEPSHGILEFADKQVTAMIEITIIDDAEFELVEVFNISLIKVTGGGRLGDDVV
VTVVIPQNDSPFGVFGFEEKTVMVDESFLSDDPDSYVTLTVVRSPGGKGAVRLQWTVDEM
AKDELSPLNGTLHFDETESQKTIVLHTLQDTVLEEDRRFTIQLMSLDEVEISPVKGSASI
IIRGDKGASGEVGIAPSSRHVLIGEPSAKYNGTAIISLVRGPVISGEVTVYWRIFPPSVG
EFAETSGKLTMRDGQSAAIVVIQALNDDIPEEKHFYEFQLAGISEGGRLSESSSTANITM
AASDFPYGQFAFSHEQLRVAEAAQRVNITVLRSGGSSGPVRLCYETLSGTAEAGLDFIPA
SGELLFEAREVAKSLHIEMLDDGLPEGPEEFSLVITKVELLGRGYDFTIQENGLQVDQPP
EIGNISIVRIVIMKNDNAEGIIEFDPRYTAFEVEEDVGMVMIPVVRLHGTYGRVTADFIS
QSASAVPGGVDYVLHGSSVTFQHGQNLSFINISIIDDNESEFAEPIEILLVGATGGAVLG
RHLVSRVTIAKSDSPFGVVRFLNQSKISVPNPNSTMILPLLLERTGGLSGEIQVHWEIVG
PNSQEALAPQNRDIADPVSGSFYFGEGEGGVRTILLMIYPHEETEVEKTFIIKLQLVKGE
AKLDSRAKDVILTIQKSGDPNGVVQFAPESLSEKTYSEPSALEGPLTITFFVRRVKGISG
AITVYWEISSEFDITGDFLSAKGFFTIADGEGEVTFDVHVLPDDVPEVEEDYVMQLVSVE
GGAELDPEKCITRFSVSANDDPHGVFALHSDHQSIFIGQNLSRFIQINITRLAGTFGEVA
VGYRISSDQKEQPIVTENAERQLVVQDGARYKVDTVPVKSQVFLSLGSNFTLQLVTVMLV
GGRFYGMPKILQEAKSAVLSVPEEAANSQVGFASTAFPLVDITAGTSHVVVSRRGTYGSL
TVAWAAGYAPGSEIPEFIVVGNMTPELGDLSFSHGEQSRGVLLWTFPSPGRPEAFVTHLS
GVQSGAPGGAQLRSGFTVAEIEPMGVFQLSPSSRNIVVAEDTQTIRLHVQRLFGFHGDLV
KVSYQTTAGSAKPLEDFEPVQNGELLFQKFQAEVDFEIIIINDQLSEAEEIFYVNLTSVE
MKGLQKFDANWRPRLNLDFSVAVITILDDGDLAEMDVSFPKTTVAVATDTALIPRETDSS
TTLSETTKITAIPQPTEIVATVTEAGGTYAIPGKLVTLPGTSAMSEKPDVTTVTASVAIH
GTFSLGPSRVYVEEEMKNGTFNVAEVLIRRTDGFTGNVSVTVKTFGERSAQKEPSTFPLR
DVYGISNLTWAIEEEDFEEQSVILSFVDGERERKILVQILDDEEPEGQEFFFVFLTDPQG
GAQIVKEKDDAGFAAFAMIIIAGSDLHNGILGFSEESQSGLELGEGAEPRRLHLIVTRQP
DRAFEDVKVFWRVTFNKTSTVLQKDGVNLVDELLSVSGTTICTAGQTKCFITIELKAGKR
PQVEMHFFVELYEVTAGAAINDSARFAQVKFLQSDEPQSLVYFSVGSRLPVAHKKATLVS
LQVARDSGTGLMMTVNFSTQELRSAETVGRTLISPAISGKDFVRTEGTLVFEPGQRNTVL
DVILTPDTGSLNPFPKRFQIVLSDPKGGARIDKAYGTANITLVSDADSQAVWGLADQLQQ
PLDGDILNRVLHSISMKVATENTDEQLSAVMHLIDKITIEGKNQAFSIESRNLFYEILCA
LINPKRKDTRGFSPFTEVTEKFAFSLLTDITCGSPGEKSKTILDSCPYLSILALHWYPQQ
INGHKFEGKEGDYIRIPERLLDVQDAEIMTGKSTCEFVQFTEYSSQQWFITGNGLPALRN
KVLSLSVKGQSSQPLTDNNEVVYRIYAAEPRIVPQTSLCLLWNQAAASWLSDSEFCKVVE
DTSDYVECACSYMSVYAVYAQTDNLSSYNEAFFSSGFICISGLCLAVLSHIFCARYSMFA
AKLLTHMMAASLGTQV
Download sequence
Identical sequences F6YYZ0
ENSECAP00000019160 ENSECAP00000019160 9796.ENSECAP00000019160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]