SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019318 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019318
Domain Number 1 Region: 351-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-53
Family SPRY domain 0.0000377
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily RING/U-box 5.08e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019318   Gene: ENSECAG00000021887   Transcript: ENSECAT00000023333
Sequence length 537
Comment pep:known chromosome:EquCab2:2:23887722:23915794:1 gene:ENSECAG00000021887 transcript:ENSECAT00000023333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANITVSYSSYLRDAVSDAQRHSVACSVTQLPECLCPAGSSLCCFFSQERAAF
IHSGWEVPSLAQGHTAIGGRAGIQTRVCLAQNSPFSHQLCREEQEHQGSPASSLGKFIPE
KNTYCDVNRELKEQLQALQDSEREHTEALQLLKRQLAETKVKRSKHSPLSSSTKSLRTTI
GEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAE
TDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALT
LDPGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSGGVHYWEVVVA
EKTQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGV
FLDYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
Download sequence
Identical sequences F6X4R2
ENSECAP00000019318 9796.ENSECAP00000019318 ENSECAP00000019318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]