SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019319 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019319
Domain Number 1 Region: 568-642,685-896
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-80
Family Protein kinases, catalytic subunit 0.00000000261
Further Details:      
 
Domain Number 2 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.74e-64
Family Ephrin receptor ligand binding domain 0.00000337
Further Details:      
 
Domain Number 3 Region: 275-479
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-35
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 4 Region: 903-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-20
Family SAM (sterile alpha motif) domain 0.00032
Further Details:      
 
Domain Number 5 Region: 204-267,313-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000116
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019319   Gene: ENSECAG00000021735   Transcript: ENSECAT00000023334
Sequence length 980
Comment pep:known chromosome:EquCab2:19:57079279:57786398:-1 gene:ENSECAG00000021735 transcript:ENSECAT00000023334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPW
VLGTCKETFNLYYVESDESHGIKFKPSQYTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSC
VKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCQACRPGFYKAFAGNTKCSKC
PPHSLTYMEATSVCQCEKGYFRAEKDPASMACTRPPSAPRNVIFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIE
AMNGVSELSFSPKPFTAITVTTDQDAPSLIGMVRKDWASQNSIALSWQAPAFSNGAILDY
EIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTAAGYSGYSQKFEFETGD
ETSDLAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQNG
HLRFPGVKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTPGKR
EIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSF
LRAGFLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLV
GMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGG
KIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLP
APMGCPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRSPSALHTLVEDVLVMPESPGE
VPEYPLFVTVGDWLDSIKMGQYKNNFMAAGFTTFDLISRMSIEDVRRIGVILIGHQRRIV
SSIQTLRLHMTHIQEKGFHV
Download sequence
Identical sequences F6X4Q2
ENSECAP00000019319 9796.ENSECAP00000019319 ENSECAP00000019319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]