SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019326 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019326
Domain Number 1 Region: 120-177
Classification Level Classification E-value
Superfamily BPTI-like 4.4e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0013
Further Details:      
 
Domain Number 3 Region: 212-270
Classification Level Classification E-value
Superfamily BPTI-like 8.94e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019326   Gene: ENSECAG00000021849   Transcript: ENSECAT00000023342
Sequence length 305
Comment pep:known chromosome:EquCab2:18:64189190:64264609:-1 gene:ENSECAG00000021849 transcript:ENSECAT00000023342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYTMKKEQICWASICLLLGCASAPLNAAPQESEEHTNITDAELPPLKPLHSFCALKADD
GPCRAMIKRFFFNIHTQQCEEFVYGGCEGNQNRFESLEECKEKCIRESSKIIIKGTLQKE
KPDFCFLEEDAGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFDSLEECKNACEDALN
DFQVDDHRTQINAVNNDSLTPQPTKVPNFWEFYGPSWCLTPADRGLCQANESRFYYNSII
GKCRPFKYSGCGGNENNFTSKRACLKACKKGFIQRISKEGLIKTKRKRKKQPVKIVYEKI
FVKKT
Download sequence
Identical sequences F6X3Z5
ENSECAP00000019326 9796.ENSECAP00000019326 ENSECAP00000019326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]