SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019330 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019330
Domain Number 1 Region: 1729-1954
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-49
Family Ankyrin repeat 0.000000185
Further Details:      
 
Domain Number 2 Region: 1072-1213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000149
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 759-892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 4 Region: 531-660
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000994
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 5 Region: 349-472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 468-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 145-280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 883-1003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 1043-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000062
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 119-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 11 Region: 1211-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 13 Region: 82-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 314-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family EGF-type module 0.038
Further Details:      
 
Domain Number 16 Region: 696-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000822
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 734-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000004
Family EGF-type module 0.021
Further Details:      
 
Domain Number 18 Region: 1011-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000547
Family EGF-type module 0.057
Further Details:      
 
Domain Number 19 Region: 653-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000804
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 41-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019330
Domain Number - Region: 1254-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019330   Gene: ENSECAG00000021331   Transcript: ENSECAT00000023346
Sequence length 1956
Comment pep:known chromosome:EquCab2:21:477824:505007:-1 gene:ENSECAG00000021331 transcript:ENSECAT00000023346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVA
GTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRYICSCPPGYQGRSCRSDV
DECRVGGPCRHGGTCLNTPGSFHCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQGGDLS
YDCACLPGFEGQNCEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQ
LQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCA
CPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGA
NPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMA
GFTGTFCEVDMDECQSSPCVNGGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNG
AKCVDQPDGYECRCAEGFEGTLCELNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRC
ESQVDECRSQPCRHGGKCLDLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGIN
RYDCVCQPGFTGPLCNVEINECASSPCGEGGSCVDRENGFHCLCPPGSLPPLCLPPSHPC
AQEPCSHGVCHDAPGGFRCVCEPGWSGPRCSQSLARDACESQPCQAGSTCTTDGMGFRCI
CPPGVQGRQCELLSPCSPNPCEHGGHCESAPGQLAVCSCPPGWQGPRCQQDVDECAGPSP
CGPHGACTNLAGSFSCTCHSGYSGPSCDQDIDDCNPNPCLNGGSCQDGVGSFLCSCLPGF
AGPRCALDVDECLSSPCGPGTCADHVASFACTCPPGYGGFRCEQDLPDCSPSSCFNGGTC
VDGVNSFSCLCRPGYTGAHCQHEADPCLSRPCLHGGICTAAHPGFRCTCPEGFTGVQCQT
LVDWCSRAPCQNGGRCARTGASFHCLCAPGWSGRLCDVQSLPCREAAAQIGVRLEQLCQA
GGQCVDKDSSHYCMCPEGRTGSYCEQEVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTGD
NCEDDVDDCASQPCQHGGFCIDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLALGPQCL
HNGTCVDLVGGFRCTCPPGYTGLRCEADINECRLGACHAAHTRDCLQDPGGGFHCLCRAG
FTGPRCQTVLSPCESQPCQHGGQCRPSPGPGGALTFTCHCVPPFWGPHCERVAHSCRELQ
CPAGVPCQQTARGPRCACPPGLSGPACRSRGSPPGAANNNCAASPLSVPCIPSVHPVLCP
FWRSVCLCWPGTLPSPASPCPPPLPSCPLLAELQPPWLLCFFSDTPGLVPPCTGCSFSLD
CSSLRKLHGSSLTAFNSEPAAAVDTFWFSCARAVCHLSRWYEKYCAEPLFPMGCCDPANT
NKGGWKGKRNMQMKKEAEKERERDETVPQPSLSHRFWLYSSSSYLQKGALIHTVYLRRGV
DVRGQEGGLPSLQSPGEREAAAREIGEPGCGSVVMLEIDNRACSRPENDHCFPDAQSAAD
YLGALSAVERLDFPYPLRAARGEPLELPLPRVPLLPLLAASAVFLLVILVLGVMVARRKR
EHSTLWFPEGFALHKEVAAGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEA
KRLKVEEPSVGAEDAVDCQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGF
TPLMLASFCGGALEPMPTEEDEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYA
RADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTAL
ILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDS
KEETPLFLAAREGSYEAAKLLLDHFANREITDHLDR
Download sequence
Identical sequences F6WZX4
9796.ENSECAP00000019330 ENSECAP00000019330 ENSECAP00000019330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]