SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019341 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019341
Domain Number 1 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-34
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 338-457
Classification Level Classification E-value
Superfamily TIMP-like 2.2e-33
Family Netrin-like domain (NTR/C345C module) 0.00000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019341   Gene: ENSECAG00000021766   Transcript: ENSECAT00000023358
Sequence length 459
Comment pep:known chromosome:EquCab2:13:8629026:8634028:1 gene:ENSECAG00000021766 transcript:ENSECAT00000023358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLLTAWALLPFAQGQTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL
VAPGNQVTLRMTADEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPDQVISLTFGKFDLESDTYCRYDSVSVFNGAVSDDAKRLGKFCGDTA
PGPISSEGNELLVQFVSDLSVTADGFSASYRTLPRGAAKEGPAQSPGEDARPGPPLLGPG
PKPGAGPKVKPKLPPAEKPKASPEAKATLVGPDALGVPCPKQCRRTGTLQSNFCASNLVV
TATVKSMVRGPGEGLTVTVSLIGAYKTGGLDLPSPPTDTPLKFYVPCKQCPPMKKGASYL
LMGQVEENRGPVLPPESFVVLYRPNQDQILTNISKRCPS
Download sequence
Identical sequences F6WZ69
ENSECAP00000019341 XP_001505108.3.31192 XP_008525558.1.77740 ENSECAP00000019341 9796.ENSECAP00000019341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]