SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019347 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019347
Domain Number 1 Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000363
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 471-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.0017
Further Details:      
 
Domain Number 4 Region: 139-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019347
Domain Number - Region: 840-1077
Classification Level Classification E-value
Superfamily Tropomyosin 0.000327
Family Tropomyosin 0.0095
Further Details:      
 
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 1041-1171
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019347   Gene: ENSECAG00000021903   Transcript: ENSECAT00000023364
Sequence length 1190
Comment pep:known chromosome:EquCab2:5:20220497:20271869:1 gene:ENSECAG00000021903 transcript:ENSECAT00000023364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLSCYLCFSLLLPAARATSGREVCDCNGKSRQCIFDQELHKQTGNGFRCLNCNDNT
DGIHCERCKAGFYRQRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCAQDQRLLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDGGN
PQGCTQCFCYGHSASCHSSGDYSVHKIISAFHQDVDGWKAVQRNGSPAKLQWSQRHRDIF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLSKTLPCGITKTYTFRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCVCPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIPECADCPIGFYNDPQDPRSCKPCPCRNGFSCSVMPETEEV
VCNNCPQGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNNNVDPSASGNCDRLTGRCL
KCIHNTAGVHCDQCKAGYYGDPLAPNPADKCRACNCNPVGSEPVECRSDGSCVCKSGFGG
LSCEHAALTSCPACYNQVKVQMDQFMQQLQILEALISKAQGGAVPNAELEGRMQQAEQAL
RDILREAQISQDAVRSFNLRVAKARTQENSYRDRLDDLKMTVERVRALGSQYQNQVQDTR
RLITQMRLSLEESEASLQNTNIPPSEHYVGPNGFKSLAQEATRLADSHVQSASNMEQLAK
ETQEYSKELMSLVREALQEGGGSGSLDGAVVQRLVGKLQKTKSLAQELSREATQTDMEAD
RSYQHSLHLLNSVSQIQGVNDQSLQVEAKRLRQKADSLSNRVTKHMDEFKHVQSNLGNWE
EETRQLLQNGKNGRQTSDQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFDLQVG
DKRAEAEEAMKRLSYISQKVAGASDKTKQAEAALGSAAADAQRAKNAAREALEISGKIEQ
EIGGLNLEANVTADGALAMEKGLATLKSEMREVEGELSRKEQEFDMDMDAVQMVIAEAQR
VENRAKNAGVTIQDTLNTLDGILHLIDQPGSVDEERLILLEQKLFRAKTQINSQLRPLMS
ELEERAHRQKGHLRFLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
Download sequence
Identical sequences F6WZ08
9796.ENSECAP00000019347 ENSECAP00000019347 ENSECAP00000019347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]