SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019373 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019373
Domain Number 1 Region: 265-632
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.38e-105
Family beta-glycanases 0.00000074
Further Details:      
 
Domain Number 2 Region: 2-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.55e-42
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00057
Further Details:      
 
Domain Number 3 Region: 157-266
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000863
Family beta-Galactosidase/glucuronidase domain 0.0063
Further Details:      
 
Domain Number 4 Region: 741-821
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000106
Family beta-Galactosidase/glucuronidase domain 0.0071
Further Details:      
 
Domain Number 5 Region: 638-737
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000374
Family beta-Galactosidase/glucuronidase domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019373   Gene: ENSECAG00000021588   Transcript: ENSECAT00000023394
Sequence length 821
Comment pep:known chromosome:EquCab2:3:37204059:37306787:1 gene:ENSECAG00000021588 transcript:ENSECAT00000023394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPYYRFNDLSYRWISLDNWTYSKEFKIPFDISKWQKVNLIFEGVDTVTKVLLNDVTIGE
TDNMFKRYSFDVTNVVRDVNSIELRFQSPVLYAAQQSKAHTRYEVPPDCPPLVQKGECHV
NFIRKEQCSFGWDWGPSFPTQGIWKDVRVEAYNLCQLNYFTFSPIYDARAQEWNLEIESS
FDVVSSKPVYGHVMVALPKLQTQQTQGIELQPGERVVELFVKINKNISVETWWPHGHGNQ
TGYNMTILFELDGGLSIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGLPIFLKGSNWI
PADSFQDRVTSDLLRLLLQSAVDANMNTLRVWGGGVYEQDEFYELCDELGIMVWQDFMFA
CALYPAGQGFLDSVRAEVAYQARRLKSHPSIITWSGNNENEAALMMNWYGIHISDLPTYI
NDYVTLYVKNIREIVLTADKTRPFITSSPTNGAESVAEGWVSHNPYDKHFGDVHFYDYIS
DCWNWKIFPKARFVSEYGYQSWPSFSTLEKISSEEDWSCGSRFSLHRQHHADGNTEMLLQ
AGLHFKLPQSKDPLRSFKDTIYLTQVMQAQCVKTQTEFYRRSRSQVVHGEGHTMGALYWQ
LNDIWQAPSWASLEYGGKWKMLHYFARHFFAPLLPVGFENQDVFFIYGVSDLRSECNVTL
TVRLHAWSSLEPLCSRRTRRLVMKAGKATLLYKEPVPRLLKTCGTCTRQRCVVSFHLSAA
GQLLSPTNYHFLSSLKEAVGLHKAHITAVISQRGDTFVFDLETSAVAPFVWLDVGNIPGR
FSDNGFLMTGKTRTVLFYPWKPTSKSELERSFQVTSLTDIY
Download sequence
Identical sequences F6WRK2
9796.ENSECAP00000019373 ENSECAP00000019373 ENSECAP00000019373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]