SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019408 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019408
Domain Number 1 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000124
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 2 Region: 644-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000513
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000944
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019408   Gene: ENSECAG00000021639   Transcript: ENSECAT00000023434
Sequence length 934
Comment pep:known chromosome:EquCab2:21:25050815:25106010:1 gene:ENSECAG00000021639 transcript:ENSECAT00000023434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSILYFILLSALIDKSQACFCDHYPWTQWSSCSKTCNSGTQSRWRQIVIDQYYLDNS
CDQLCTKQETRECNWQTCPINCLLGDYGPWSDCDPCVEKQFKVRSILQPSQFGGQPCSEP
LMTFRPCIPSKLCKIEEIDCKNKFRCDSGRCIASKLECNGENDCGDNSDERNCGRKKAVC
SRKYDPIPSVQLMGTGFHFLAGEPRGEVLANSFTGGICKTVKSSKASNPYRVPANLESVN
FEVQTKEDDLETDFYKDLIPLGKNENQQASASGVGSSNFHFPVFYSSKRSEISTHSSAFK
QAIQASHKKDSSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFISGSLGGAYDLLYQYSSEELRNSGLTEEEVQHCIRIETKKRFLFVKKTKVEHRC
TTNKLSEKYEGSLLQGAEKSISLVRGGRSQYAAALVWEKGSSGPEEKVFSEWLESVKENP
AVIDFELAPISDLVRNIPCAVTRRNNLRKAFREYAARFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCERRSLDYKSTAVDGYWGCWSSWSPCDATYKRSRTRQCNNPAPQRGGKP
CDGERRQEERCTFSIMENTGQPCISDDEDVKEIDLPEIESDSGCPQPVPPENGFIRNEKK
LYSVGEEVEILCLTGFQTVGYQYFRCLPDRTWRRGDVECQRTGCLKPVVQEVLTVSPFQR
LYKIGESIELTCPKGFVVAGPSRYTCSGDSWMPPISDSLTCEKDILTKLKGRCQPGQKQL
GSECVCMSPEEDCSHYSEDLCVFDTDSDHYFTSPTCKFLAKKCLNYQQLHFLHVGSCQDG
PQLQWGLERTKLSSNSTKKESCGYDTCYDWEKCSAPTSKCVCLLPPQCFKGGHQLYCVKM
GSSTSKKTVNICEIGAVRCANRKVEILHPGRCLV
Download sequence
Identical sequences F6YQL3
XP_001496433.1.31192 XP_014590380.1.31192 ENSECAP00000019408 ENSECAP00000019408 9796.ENSECAP00000019408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]